KEGG   Castor canadensis (American beaver): 109682997Help
Entry
109682997         CDS       T04791                                 

Gene name
Sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04068  FoxO signaling pathway
ccan04146  Peroxisome
ccan04211  Longevity regulating pathway
ccan04213  Longevity regulating pathway - multiple species
ccan05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109682997 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109682997 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    109682997 (Sod2)
   04213 Longevity regulating pathway - multiple species
    109682997 (Sod2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    109682997 (Sod2)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109682997 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 109682997
NCBI-ProteinID: XP_020014209
UniProt: A0A250YCN7
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MLCRVASSAGRSLSPALGALGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEERYQEALAKGDVTAQVALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKAKLTAVSAGVQGSGWGWLGFNKEQGYLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggtggcgagcagcgcgggccggagtttgtccccagcgttgggggctctg
ggctcccggcagaagcacagtctccccgacctgccttacgactatggcgccctggagccg
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacttgaacgccaccgaggagaggtaccaggaggcgctggccaagggagatgttacggct
caggtagctcttcagcctgcactgaagttcaatggtggaggtcatatcaatcacactatt
ttttggacaaacctcagcccgaatggtggaggagaacccaaaggagagttgctagaagcc
atcaaacgtgactttggctcatttgaaaagtttaaggcgaagttgacagccgtgtctgct
ggtgtccaaggctcaggttggggttggcttggcttcaataaggaacagggatacttacag
attgctgcctgttccaatcaggatccattgcaaggaacaacaggccttattccactgctg
gggattgacgtgtgggaacatgcttactaccttcagtataaaaatgtccggcctgactat
ctgaaagccatctggaatgtaatcaactgggagaatgtaactgaacgatacatggcatgc
aaaaagtaa

DBGET integrated database retrieval system