KEGG   Castor canadensis (American beaver): 109683147Help
Entry
109683147         CDS       T04791                                 

Gene name
Tk1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00240  Pyrimidine metabolism
ccan00983  Drug metabolism - other enzymes
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    109683147 (Tk1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109683147 (Tk1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     109683147 (Tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 109683147
NCBI-ProteinID: XP_020014419
UniProt: A0A250XWQ8
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MSYINLPNVLPSSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSNSFSTHDRNTMEAVAACQLCDVAQEARGVAVVGIDEGQFFPDIVEFCEEMANNGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADK
YHSVCRLCYFKKPPVQAPRLDDKENWPMLGKPGEATAVRKLFGPQQVLQFSSVH
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctacatcaacctgcccaacgtgctgcccagctcccccagcaagacccggggccag
atccaggtgattctcgggcccatgttctcaggaaaaagcactgagttgatgagacgggtc
cgccgctttcagatcgcccagtacaaatgcctggtcatcaaatacgccaaagacacgcgc
tacagcaacagcttctccacacatgaccggaacaccatggaggcagtggcagcctgccag
ctctgcgatgtggcacaggaggcccggggtgtggctgtcgtgggcattgacgaagggcag
tttttccctgacatcgtggagttctgtgaggaaatggccaacaatggaaagaccgtgatt
gtggcagccctggatgggaccttccagaggaaagctttcggcaccatcttgaacctggtt
cccctggcggagagtgtggtgaagctgacagcagtgtgcatggagtgcttccgggaagct
gcctacaccaagagactgggcctagagaaagaggtggaggtgattggtggagcagacaaa
taccactctgtgtgtcgcctctgctacttcaagaagcctccagtccaggctccaaggctg
gacgacaaagagaactggccaatgttgggaaagccaggggaggccacagctgtcaggaaa
ctctttggcccccaacaggtcctacagttcagctctgtccactga

DBGET integrated database retrieval system