KEGG   Castor canadensis (American beaver): 109683946
Entry
109683946         CDS       T04791                                 

Gene name
Ptgdr
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109683946 (Ptgdr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ccan04030]
    109683946 (Ptgdr)
G protein-coupled receptors [BR:ccan04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    109683946 (Ptgdr)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 109683946
NCBI-ProteinID: XP_020015641
LinkDB
Position
Unknown
AA seq 358 aa
MRSPSYSCHNTTSVEKGHSATMGGMLFSAGLLGNLLALGLLAHSGLGFCRQRPPRPPPSV
FYVLVCGLTIFDLVGKCLLSPVVLVAYAQNQTLSGLAPAPNNWLCQAFAFTMSYFGLAST
LQLLAMALECWLSLGHPFFYQRHVTLRRGLLVAPIVGAFCLVFCALPFAGFGKYVQYCPG
TWCFIQMVHEEGSLSVLCYSVLYSSLMALLVLAIVLCNLGAMRNLYVMHRRLQRHPRCCT
RDRAEPGAGKKEASSHPLEELDHLLLLALMTALFALCSLPLIYHAYHGAFSAVSYASEEL
DSLQALRFLSVISIVDPWIFIIFRTSVFRMFFHKIFIRPLKCRNWHSHSCQSNMESSL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaggtcgccttcctacagctgccacaacaccacctcagtagagaagggccactcggcg
acgatgggcgggatgctcttcagcgcgggcctcctgggcaacctgctggccttggggctg
ctggcgcactcagggctgggtttctgccggcagcgcccaccgcgcccgccgccctcggtc
ttctacgtgctggtgtgcggcctgacaatcttcgatttggtgggcaagtgtctcctgagc
cccgtggtcctggttgcctacgcgcaaaaccagaccctctcgggcttggcgcccgcgccc
aacaactggctgtgccaagccttcgccttcaccatgtcttactttgggctcgcctcgacg
ctccagctcctggccatggcgctggagtgctggctttccttaggacaccccttcttctac
caacggcatgtcaccctgcgccggggcttgctggtggcgccgattgtgggtgccttctgc
ctggttttctgcgcgctccctttcgcgggcttcgggaaatacgtgcagtactgtcccggc
acctggtgctttatccagatggtccacgaggagggctcgctctccgtgctgtgctactct
gtgctctactccagtctcatggcgctgctggtcctcgccatcgtgctgtgcaacctgggc
gccatgcgcaacctctacgtgatgcaccggagactgcaacgccacccgcgctgctgtacc
agggaccgcgcggagcccggggctggaaagaaggaggcgtcgtcgcatcccctggaggag
ctggaccacctgctgcttttggcgctcatgaccgcgctcttcgccttgtgctccctgcct
ttaatttatcacgcgtaccacggagcattctcagctgtcagctatgcctctgaagaactg
gacagcctccaagccttgcgttttctgtctgtgatttcaattgtggacccttggattttc
atcattttcaggacttcagtatttcggatgttttttcacaagattttcataagacctctt
aagtgtagaaactggcacagtcattcctgccaaagtaatatggaatccagtttgtga

DBGET integrated database retrieval system