KEGG   Castor canadensis (American beaver): 109684212Help
Entry
109684212         CDS       T04791                                 

Gene name
Gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00500  Starch and sucrose metabolism
ccan01100  Metabolic pathways
ccan04151  PI3K-Akt signaling pathway
ccan04152  AMPK signaling pathway
ccan04910  Insulin signaling pathway
ccan04922  Glucagon signaling pathway
ccan04931  Insulin resistance
Module
ccan_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109684212 (Gys2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109684212 (Gys2)
   04152 AMPK signaling pathway
    109684212 (Gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109684212 (Gys2)
   04922 Glucagon signaling pathway
    109684212 (Gys2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    109684212 (Gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccan01003]
    109684212 (Gys2)
Enzymes [BR:ccan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109684212 (Gys2)
Glycosyltransferases [BR:ccan01003]
 Polysaccharide
  Storage polysaccharide
   109684212 (Gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 109684212
NCBI-ProteinID: XP_020016068
UniProt: A0A250YKS8
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEAEHLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPINDTVRRAVEAMNKHGCQVHFGRWLIEGSPYVVLFDI
GSSAWNLDRWKGDFWEACSVGIPHHDREASDMLIFGSLTAWFLKEVTDYADGKHVIVQFH
EWQAGTGLILSRARNLPIATIFTTHATLLGRYLCAANTDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSSV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQA
HVADPTAYGIYIVDRRFCSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRFYQHARHLTLSRAFPDKFHMEPTLPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DENEDERYDEEEEAERDRLNIKSPFSPSHAPRGKKKLHGEFKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccggtccttatctgtgacatccctgagtgggcttcctcagtgggaagcc
gaacaccttcctgtggaggatttattgctctttgaagtttcctgggaagtcaccaacaaa
gttggtggcatatatactgtcattcagacgaaggccaaaacaacagcagatgaatgggga
gaaaattattttttgattggcccatattttgagcacaacatgaagactcaggtggagcag
tgtgaacctataaatgatactgtcagaagagcggtggaggcaatgaataagcacggctgc
caggtgcattttgggagatggctgatagaagggagtccttatgtggtgctctttgacata
ggctcttcggcgtggaatctggacaggtggaagggagacttctgggaagcatgcagtgtt
ggcatccctcatcatgaccgagaagccagtgacatgctcatatttgggtctttgactgcc
tggttcttaaaagaggtgacagactatgcagatggcaaacatgtcattgttcaattccat
gaatggcaggcgggaactgggctgatcctttctcgagcccggaatctccctattgccaca
atattcacaacccacgccacactacttgggaggtatctctgtgcagcaaacactgacttc
tacaaccatcttgacaagtttaacatagacaaagaggctggggaaaggcagatataccac
cgttactgcatggagcgagcctctgtacactgtgctcatgtgttcaccaccgtttctgaa
ataacagccatcgaggcagagcacatgctgaagagaaagcctgatgtagttactccgaat
ggcttgaatgtgaagaagttttcagctgtacatgaatttcaaaatctacacgccatgtac
aaggccaggatccaagactttgttcggggccatttctacggtcacctggattttgatctt
gaaaagacattattccttttcattgctgggaggtatgagttctcaaataaaggtgcggac
atcttcttagagtccttatccaggctaaacttccttctgaggatgcataaaagcagtgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaatgtggaaactttg
aaaggacaagcggtgcgaaaacagctctgggacactgtacattctgtgaaggaaaagttt
ggaaagaaactgtatgatgccttgttaagaggagaaatacctgacatgaataatattttg
gaccgagatgacctaacaattatgaaaagagccatcttttcaactcagcgacagtctttg
cctccggtgaccacccacaatatgattgatgactcaacagatccaatcctcagcaccatt
aggaggattggacttttcaacaatcgtgcagacagagtcaaggtgattttgcacccagag
ttcctatcctccaccagccccttattaccaatggattatgaagagtttgtccgaggttgt
catcttggggtattcccgtcatactatgaaccctggggttatactccagctgaatgcacg
gtgatgggcatccccagcgtgacaacaaacctgtccggctttggttgcttcatgcaggcg
cacgtggctgatcctactgcttatggtatttacattgttgacaggagattctgctctcca
gatgattcttgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgc
caaagaattatccagaggaaccggactgagaggctctcagacctactggactggagatac
ctaggcagattttaccagcatgccagacacctgacgttaagcagagcttttccggataaa
ttccatatggaacccacattaccaccgacgacagaaggatttaaatatcccaggccctcc
tcagtaccaccttctccatcgggctctcaggcctccagccctcagagcagtgatgtggaa
gatgaaaatgaggatgagcgatacgatgaggaagaagaggctgaacgggatcggctaaac
attaagtcaccattttctccgagccacgctcctcgggggaaaaaaaaactgcatggtgaa
ttcaagaactga

DBGET integrated database retrieval system