KEGG   Castor canadensis (American beaver): 109684706Help
Entry
109684706         CDS       T04791                                 

Gene name
Gaa
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00052  Galactose metabolism
ccan00500  Starch and sucrose metabolism
ccan01100  Metabolic pathways
ccan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109684706 (Gaa)
   00500 Starch and sucrose metabolism
    109684706 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109684706 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109684706 (Gaa)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109684706 (Gaa)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109684706 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109684706
NCBI-ProteinID: XP_020016804
UniProt: A0A250Y6G4
LinkDB All DBs
Position
Unknown
AA seq 979 aa AA seqDB search
MRWSRCSHALKGVCAIAFLATAALLGHVLLHDFPVVPRDLDGPSQGLEETPGASHQGSRR
LQPRHIREHPGWPRAAPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYVPAWQGPQGPLM
GQPWCFFPPSYPGYRLENLSSSETGYTATLTRAVPTFFPKDILTLRLDVLMETESRLHFT
IRDPANKRYEVPLETPRVHSRASSPLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLIFA
DQFLQLATSLASRYITGLAEHLSPLMLSTNWTRITLWNRDLAPTPGANLYGSHPFYLALE
DGGLAHGVFLLNSNAMDIVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDIVGFPF
MPPYWGLGFHLCRWGYSSTAIIRQVVENMTRAQFPLDVQWNDLDYMDGRRDFTFNKDGFA
DFPAAVRELHQGGRRYILIVDPAISSAGPAGSYRPYDEGLRRGVFITNETGQPLMGKVWP
GSTAFPDFTNPEALDWWQDMVTEFHAQVPFDGMWIDMNEPSNFLWGSEHGCPNNELENPP
YVPGVVGGTLQAATICASSHQFLSAHYNLHNLYGLTEAIASNMALEKARGTRPFVISRST
FSGHGRYAGHWTGDVWSSWEQLYYSVPEILQFNLLGVPLVGADICGFLGNTSEELCVRWT
QLGAFYPFMRNHNDLHSLPQEPYVFSEPAQQAMRKAFALRYTLLPYLYTLFHRAHVSGET
VVRPLFLEKTQCIWPERFIYASKKTRMTRAGKDTESRFPEDPQTWAVDRQLLWGEALLIT
PVLEPGKAEVTGYFPVGTWYSLHTVPVEALGSLPTPPPEPLRSAIHSKGQWVTLPAPLDT
VNVHLRAGYIVPLQGPALTTTESRKQPVALAVALTASGKACGELFWDDGESLGVLERGAY
TQVTFLARNNTLVNELVHVSREGADLQLRKVTILGVATAPHRVLSNGVPVSNFTYSPDSQ
LLAVPVSLYVAEQFHISWA
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtctcgctgctctcacgccctaaaaggagtttgcgccatcgccttcttggcc
acagctgcccttctggggcatgtcctgctccatgacttcccggtggtcccccgagatctg
gatggcccctcccaaggattggaagagactcctggagctagccatcaaggaagcaggagg
ctccagccccgacacatccgggagcacccgggctggcccagagcagcacccacacaatgt
gatgtgccccccaacagccgcttcgactgtgccccagacaaagccatcacccaggagcag
tgtgaggcccgtggctgctgctatgtccctgcatggcaagggccacagggccccctgatg
gggcagccctggtgtttcttcccacccagctacccaggctaccggctagagaatctgagc
tcctcggagacgggctacacagccaccctgacccgtgctgtccccaccttcttcccaaag
gacatccttaccttacgactggatgtgctgatggagactgagagccgcctccacttcaca
atcagagaccctgccaacaagcgctacgaggtacccttggagacaccccgtgtacacagc
cgggcgtcatccccactctacagtgtggaattctcggaggagccttttggggtggttgtg
cgtcggaagctggatggccgggtgctgctgaacaccactgtggccccgctcatcttcgct
gaccagtttctgcagctggccacctcactggcctcccggtacatcacaggcctcgcggag
cacctcagccccctgatgctcagcaccaactggaccaggatcactctctggaaccgggac
ttggcacccacgcctggtgccaacctctatgggtcgcaccctttctacctggctttggag
gatggtggcttggctcacggagtcttcctcttgaacagcaatgcaatggacatagtactg
cagcccagcccagcactcagctggaggtcgacaggcgggatcctggatgtgtacatcttc
ctgggcccagagcccaagagtgtggtgcagcagtacctggacattgtggggtttcccttc
atgccaccctactggggcctgggcttccacctctgccgctggggctactcgtctaccgcc
atcatccgccaggtggtggagaacatgacaagggctcagtttcctctggacgtacagtgg
aatgacctggactacatggatggccggagggactttaccttcaacaaggacggcttcgca
gactttccggccgctgtacgtgagctgcaccagggcggccggaggtacatactgatcgtg
gaccctgccatcagtagtgcaggccccgctgggagttacaggccctacgatgagggtctg
cggaggggggtcttcatcaccaatgagaccgggcagccactgatgggaaaggtgtggccc
ggatccactgccttccccgacttcaccaaccctgaggccctcgactggtggcaggacatg
gtgaccgagttccacgcccaggtgccctttgatggcatgtggatcgacatgaatgagcca
tccaacttcttatggggctctgagcatggctgccccaacaacgagctggaaaacccaccc
tatgtacctggggtggttggtggcaccctgcaggcggccactatctgtgcttccagccac
cagttcctttctgcacactacaacctccacaacctgtacggcctgaccgaagccatcgct
tccaacatggccctggagaaggctcgagggacacgaccctttgtgatctcccgttcaact
ttctctggccacggccgatacgctggccactggacaggtgatgtgtggagcagctgggag
cagctttactactcagtgccagaaatcctgcagtttaacttgctgggggtgcccctggtt
ggggcggacatctgtggcttcctgggcaacacctcggaggagctgtgtgtgcgctggacc
cagctgggggcattctaccccttcatgcggaaccacaatgacctgcacagcctgccccag
gagccatacgtgttcagtgagccagctcagcaggccatgaggaaggcctttgccctgcgc
tacacgctactaccctacctctacacgctgttccaccgcgcccacgtcagcggggagacg
gtggtccggcccctcttcctagaaaagacacagtgtatctggcccgagagatttatatat
gcctccaagaaaacgagaatgaccagagccggcaaggacacggagagcaggttccctgaa
gacccccagacctgggccgtggaccgccagctgttatggggggaggccctgctcatcaca
ccagtgctcgagccaggaaaggccgaggtgactggctatttccccgtaggcacatggtac
agcctgcacacggtaccagtagaggcgctcggcagcctccccactccacctccagaaccc
ctcaggtctgccatccacagcaaggggcagtgggtaacactgccagcccctctggacacc
gtcaacgtccacctgcgagctgggtacatcgtgcctctgcagggccctgccctcacaacc
acggagtcccgtaagcagccggtggccttggctgtggccctgacagcaagtggcaaggcc
tgtggggagctgttctgggatgatggggagagcctgggggtgctggagcgcggggcctac
acacaggtcaccttcttggccaggaataacaccctcgtgaatgagctggtgcacgtgagc
agggagggggcagacctgcagctaaggaaggtgaccatcttgggggtggccacagcgccc
caccgggttctctccaatggggtccctgtctccaacttcacctacagccctgacagccag
ctcctggctgtccccgtctcgctgtacgtggctgagcagttccacatcagctgggcttag

DBGET integrated database retrieval system