KEGG   Castor canadensis (American beaver): 109684716Help
Entry
109684716         CDS       T04791                                 

Gene name
Pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109684716 (Pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccan03110]
    109684716 (Pcsk1)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     109684716 (Pcsk1)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S8: subtilisin family
   109684716 (Pcsk1)
Chaperones and folding catalysts [BR:ccan03110]
 Intramolecular chaperones
  Subtilisin family
   109684716 (Pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 109684716
NCBI-ProteinID: XP_020016825
LinkDB All DBs
Position
Unknown
AA seq 753 aa AA seqDB search
MEPRAWSLQCTAFALFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHTNHPQRSRRSALHITKRLSDDDRVIWAEQQYEKKRSKRSALGDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPSLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKTWNTVPEKKECVVKDNDFEPRALK
ANGEVIIDIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDVAEEQPLQKGPNENPLVSKSPSSSSVGGRKDELAE
AAPSEAMLRLLQSAFSKNSSPKQSPKKSPSTKLNIPYENFYEALEKLNKPSQLKDSEDSL
YSDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagccaagagcctggagtctgcagtgtactgctttcgccctcttttgcgcctggtgt
gcactcaacagtgtaaaagcgaagaggcagtttgtcaatgaatgggcggcggagatcccc
gggggcccggaggcagcctcggccatcgccgaggagctgggctatgaccttttgggtcag
attggatcacttgaaaatcactacttattcaaacatacaaaccatccccaaaggtctcga
aggagtgcccttcatatcactaagagattgtctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaaaagagaagcaaacgttcagctttaggagactctgcactaaatctc
ttcaatgatcctatgtggaatcagcagtggtacttgcaagataccaggatgactgcagcc
ctgccaaagctggatcttcatgtgatacctgtgtggcaaaaaggcatcacaggcaaagga
gttgtaatcactgtactggatgatggcttggagtggaatcacacagacatttatgccaac
tatgatccagaggccagctatgacttcaatgataatgatcatgatccatttccccgatat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgtggggtcggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgactgatgctattgaggccagttcaattggattcaaccctggacat
gtggatatttatagtgcaagctggggccctaatgatgatgggaaaactgtggagggacct
ggtagactagcccagaaagcttttgaatatggtgtcaaacaggggagacaaggaaagggc
tctatctttgtctgggcttctgggaatggaggacgccagggagataactgcgactgtgat
ggctacacagacagcatctacaccatctccattagcagcgcctcccagcaaggcctatct
ccgtggtatgctgagaagtgctcctccacactggccacctcttacagcagtggggattac
accgaccagcgaatcacaagtgctgacctgcacaacgattgcacagagacccacacgggc
acctcggcctctgcgcccctggctgctggcatcttcgctctggccttggaagcaaaccca
agtctcacctggcgagatatgcagcacttggtcgtctggacctctgagtatgaccctttg
gccaataaccctggctggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttggcttgctaaatgccaaagctcttgtagatttagctgatcccaagacctggaacact
gtgcctgagaagaaagaatgtgttgtaaaagacaatgactttgagcccagagccctgaaa
gccaatggagaagtcatcattgacatcccaaccagagcttgtgaaggacaagaaaatgcc
atcaagtccctggaacatgtgcaatttgaagcaacaattgaatattcccgtagaggagac
cttcatgtcacactcacttctgctgctggaaccagcactgtcctgttggctgaaagggag
cgggacacatcccctaatggctttaagaattgggacttcatgtctgttcacacatgggga
gagaatccagtaggcacctggactttgagaattacagacatgtctggaagaatgcaaaat
gaagggagaattgtgaactggaagctgattttgcatgggacctcttctcagccggagcat
atgaagcaacctcgtgtatacacatcctacaacaccgttcagaatgacaggagaggggtg
gagaagatggtggatgtagcagaggagcagcccctacaaaagggcccaaatgagaacccg
ctggtgtccaaaagtcccagcagcagcagtgtggggggcagaaaggatgagctggcagag
gcggccccatctgaggccatgctacgactcctacaaagtgcttttagcaaaaactcatct
ccaaagcaatcaccaaagaagtctccaagcacaaagctcaacatcccttatgaaaatttc
tatgaagccctggaaaagctgaacaaaccttcccagcttaaagactctgaggacagtcta
tatagtgactatgttgatgttttctataacacaaaaccttataagcacagagatgaccgg
ctgctgcaggctctagtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system