KEGG   Castor canadensis (American beaver): 109684968
Entry
109684968         CDS       T04791                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04390  Hippo signaling pathway
ccan04810  Regulation of actin cytoskeleton
ccan05200  Pathways in cancer
ccan05218  Melanoma
ccan05224  Breast cancer
ccan05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109684968 (Fgf1)
   04014 Ras signaling pathway
    109684968 (Fgf1)
   04015 Rap1 signaling pathway
    109684968 (Fgf1)
   04390 Hippo signaling pathway
    109684968 (Fgf1)
   04151 PI3K-Akt signaling pathway
    109684968 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109684968 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109684968 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    109684968 (Fgf1)
   05218 Melanoma
    109684968 (Fgf1)
   05224 Breast cancer
    109684968 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccan04052]
    109684968 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ccan00536]
    109684968 (Fgf1)
Cytokines and growth factors [BR:ccan04052]
 Growth factors
  Growth factors (RTK binding)
   109684968 (Fgf1)
Glycosaminoglycan binding proteins [BR:ccan00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109684968 (Fgf1)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 109684968
NCBI-ProteinID: XP_020017188
LinkDB
Position
Unknown
AA seq 91 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHSKQP
SELYLFPFCVFFSQGQEKGRYYGAGTHSSKE
NT seq 276 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaatcacgaccttcacagctctgactgagaagtttaacctgcctccg
gggaactataagaagcccaaactgctctactgcagcaatggaggccacttcctaaggatc
cttccagatggcacagtggatgggacaagggataggagtgaccagcacagtaagcagccg
tctgaattataccttttccctttctgtgtcttctttagtcaaggacaggagaagggtagg
tattatggagctggtacccactcctccaaggagtga

DBGET integrated database retrieval system