KEGG   Castor canadensis (American beaver): 109684969
Entry
109684969         CDS       T04791                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04390  Hippo signaling pathway
ccan04810  Regulation of actin cytoskeleton
ccan05200  Pathways in cancer
ccan05218  Melanoma
ccan05224  Breast cancer
ccan05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109684969
   04014 Ras signaling pathway
    109684969
   04015 Rap1 signaling pathway
    109684969
   04390 Hippo signaling pathway
    109684969
   04151 PI3K-Akt signaling pathway
    109684969
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109684969
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109684969
  09162 Cancer: specific types
   05226 Gastric cancer
    109684969
   05218 Melanoma
    109684969
   05224 Breast cancer
    109684969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccan04052]
    109684969
   00536 Glycosaminoglycan binding proteins [BR:ccan00536]
    109684969
Cytokines and growth factors [BR:ccan04052]
 Growth factors
  Growth factors (RTK binding)
   109684969
Glycosaminoglycan binding proteins [BR:ccan00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109684969
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109684969
NCBI-ProteinID: XP_020017191
LinkDB
Position
Unknown
AA seq 105 aa
QLQLSAESVGEVYIKSTETGQYLAMDPEGLLYGSQTPDEECLFLERLEENHYNTYISKKH
AEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPCQSPLIREICSGC
NT seq 320 nt   +upstreamnt  +downstreamnt
ttcagctgcagctgagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactg
gccagtacttggccatggaccctgaggggcttttatacggctcacagacaccagatgaag
aatgcttgttcctggagaggctggaggaaaaccattacaacacctacatatccaagaaac
atgcagagaagaattggtttgttggtctcaagaagaacggaagctgcaaacgtgggcctc
ggactcactacggccagaaagcaatcctgtttctcccctgccagtctcctctgattagag
aaatctgttctgggtgctaa

DBGET integrated database retrieval system