KEGG   Castor canadensis (American beaver): 109685094
Entry
109685094         CDS       T04791                                 

Gene name
Pdgfra
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04020  Calcium signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04144  Endocytosis
ccan04151  PI3K-Akt signaling pathway
ccan04510  Focal adhesion
ccan04540  Gap junction
ccan04630  JAK-STAT signaling pathway
ccan04810  Regulation of actin cytoskeleton
ccan05163  Human cytomegalovirus infection
ccan05200  Pathways in cancer
ccan05206  MicroRNAs in cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05218  Melanoma
ccan05230  Central carbon metabolism in cancer
ccan05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109685094 (Pdgfra)
   04014 Ras signaling pathway
    109685094 (Pdgfra)
   04015 Rap1 signaling pathway
    109685094 (Pdgfra)
   04630 JAK-STAT signaling pathway
    109685094 (Pdgfra)
   04020 Calcium signaling pathway
    109685094 (Pdgfra)
   04072 Phospholipase D signaling pathway
    109685094 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    109685094 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109685094 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109685094 (Pdgfra)
   04540 Gap junction
    109685094 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109685094 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109685094 (Pdgfra)
   05206 MicroRNAs in cancer
    109685094 (Pdgfra)
   05230 Central carbon metabolism in cancer
    109685094 (Pdgfra)
   05231 Choline metabolism in cancer
    109685094 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    109685094 (Pdgfra)
   05218 Melanoma
    109685094 (Pdgfra)
   05215 Prostate cancer
    109685094 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109685094 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109685094 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109685094 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccan04090]
    109685094 (Pdgfra)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109685094 (Pdgfra)
Protein kinases [BR:ccan01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109685094 (Pdgfra)
CD molecules [BR:ccan04090]
 Proteins
  109685094 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 C2-set_2 LAT Kinase-like DUF3475
Other DBs
NCBI-GeneID: 109685094
NCBI-ProteinID: XP_020017373
LinkDB
Position
Unknown
AA seq 1090 aa
MGTSRQAFLVFGCLLTGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSVEEDPKVEIRNEENNSGLFVTVLEVVGASAAHTGLYTCYYNHTQTEENEVEGRGIYIY
VPDPDVAFVPLGMTDYLIIVEEDDSAVIPCRTTDPETPVILRNSDGLVPASYDSRQGFNG
TFSVGPYICEATVKGRKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIMLTCAVFNN
EVVDLKWKYPGEVKGKGITKLEEIKVPSIKLVYTLTVPEATVKDSGDYECTARQALTEVK
EMKKVTISVHEKGFVEIKPTFGQLEAVNLHEVRHFVVDVQAYPPPRISWLKDNSTLXENL
TEITTDVEKIQELRYRSKLKLIRAKEEDSGHYTIVVQNEDDMRSYTFELLTQVPSSILEL
VDDXHGSGGGQTVRCTAEGVPLPDIEWMICKDIKKCSNETSWTILANNVSNIITEIHPRD
GSTVEGRVTFAKVEETIAVRCLAKNLLGSGNRELSWWPPVTLRSELTVAAAVLVLLVIVI
ISLIVLVVIWKQKPRYEIRWRVIESIXPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGXHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRS
YVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKAVLDSEVK
NLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYK
KSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGSLDEQRLSADSGYI
IPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGID
SSDLVEDSFL
NT seq 3273 nt   +upstreamnt  +downstreamnt
atggggacgtcccgccaggccttcctggtcttcggctgtctcctcacagggccgagccta
atcctctgccagctctcattaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgtagaagaggaccccaaagtggaaatcagaaatgaagagaacaacagtggcctt
tttgtgacagtgctggaagtggtcggggcctcggcagcccacactggattgtacacttgc
tattacaaccacacgcagacagaagaaaatgaagttgagggaaggggtatttatatctat
gtgcccgacccagatgtggctttcgtgcccctagggatgacagattatttaatcatcgtg
gaggaagatgattctgcagtcataccttgtcgcaccacggatccagagactcctgtaatc
ttacgcaacagtgatgggctggtgccagcctcctatgacagcaggcagggcttcaatggc
accttcagtgtggggccctacatctgtgaggccactgtcaaagggaggaagtttcagacc
atcccatttaatgtctacgctttgaaagcgacatcagaactggatctagaaatggaggct
cttaaaactgtgtacaagtcaggggaaacgatcatgctcacctgtgctgtctttaacaat
gaggtggttgacctaaagtggaagtaccctggagaagtgaaaggcaaaggcatcacgaag
ctggaggaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtactgcccgccaggcccttacggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaagggttcgttgagatcaaacccacc
tttggccagttggaagctgtcaacctgcatgaagtcagacactttgtggtggatgtgcag
gcctatccccctcccaggatatcctggctgaaagacaactcaactcttnatgaaaatctc
accgagatcacaactgatgtggaaaagattcaggagttaaggtatcggagcaaattaaag
ctcatccgtgctaaggaggaagacagtggccactatacaattgtagttcaaaatgaagat
gatatgaggagctatacttttgaactgttaactcaagttccctcatccattctggagcta
gtcgatgacncccatggctctggtgggggacagactgtgaggtgcacagctgaaggcgta
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtagtaatgagact
tcatggacaattttagctaataatgtctcaaatatcatcacggagatccacccccgagat
gggagtactgtggagggccgagtgacatttgccaaagtggaggagacaattgcagttcga
tgcctggctaagaatctccttggatctgggaaccgagagctgagctggtggcccccagtg
accctgcgttctgaactcactgtggcagccgcagtcctggtgctgttggtgattgtgatc
atctcacttattgtcctggttgtcatttggaagcagaaaccaaggtatgaaattcgctgg
cgggtcattgaatcaattnagcccgatggacatgaatatatttatgtggacccgatgcag
ctgccttatgactcgagatgggagtttccaagagatggactagtgcttggtcggatcttg
ggatctggtgcatttgggaaagtggttgaaggaacagcctatggattaagccggtcccag
cctgtgatgaaggtagcggtgaagatgctcaaacccacagccaggtccagtgagaaacaa
gctctcatgtctgagctgaaaataatgactcacctggggncccatttaaacatcgtgaac
ttgctgggagcctgtacgaagtcaggccccatttacatcatcactgagtactgcttctat
ggggatttggtcaactatttgcataagaatagggatagcttcttgagccaccacccagaa
aagccgaagaaagagctggacatctttggattgaacccagctgatgagagcacacggagt
tacgtgattttgtcttttgaaaacaatggtgactacatggacatgaagcaagctgacacc
actcagtatgtgcccatgctagaaaggaaagaggtctctaagtattcagacatccagaga
tcactgtacgatcgtccagcctcgtataagaagaaagctgtgttagactcggaagtcaaa
aacctcctttcagatgataactcagaaggccttactttgttggatttgttgagtttcacc
tatcaagttgcccgaggaatggaattcttggcttcaaaaaattgtgtccacagggacctg
gctgctcgcaatgtcctcttggcacaagggaaaatcgtgaagatctgtgactttggcctg
gccagagacatcatgcatgactcgaactacgtgtcaaaaggcagtaccttcctgccagtg
aagtggatggctcctgagagcatctttgacaacctctacaccaccctgagtgacgtctgg
tcttacggcattctgctctgggagatcttttctctcggtggcacaccctaccctggcatg
atggtggactctactttctacaataagatcaagagtgggtaccggatggccaagcccgac
catgccaccagtgaagtctacgagatcatggtgcagtgctggaacagtgagcctgagaag
agaccctccttttaccacttgagtgagatagtggagaatctgctgcctggacaatataaa
aagagttacgaaaagattcacctggatttcctaaagagtgaccaccctgccgtggcacgc
atgcgtgtggactcagataatgcatacattggcgtcacctacaaaaatgaagaggacaag
ctaaaggactgggagggtagcctggatgagcagagactgagtgctgacagcggctacatc
atccctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacaga
cacagctcacagacctctgaagagagtgccattgagacaggttccagcagttccaccttc
atcaagagagaggatgagaccatcgaggacatcgacatgatggatgacattggcatagac
tcctcagacctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system