KEGG   Castor canadensis (American beaver): 109685138Help
Entry
109685138         CDS       T04791                                 

Gene name
Ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00590  Arachidonic acid metabolism
ccan01100  Metabolic pathways
ccan04064  NF-kappa B signaling pathway
ccan04370  VEGF signaling pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04657  IL-17 signaling pathway
ccan04668  TNF signaling pathway
ccan04723  Retrograde endocannabinoid signaling
ccan04726  Serotonergic synapse
ccan04913  Ovarian steroidogenesis
ccan04921  Oxytocin signaling pathway
ccan04923  Regulation of lipolysis in adipocytes
ccan05140  Leishmaniasis
ccan05163  Human cytomegalovirus infection
ccan05165  Human papillomavirus infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05200  Pathways in cancer
ccan05204  Chemical carcinogenesis
ccan05206  MicroRNAs in cancer
ccan05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109685138 (Ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109685138 (Ptgs2)
   04064 NF-kappa B signaling pathway
    109685138 (Ptgs2)
   04668 TNF signaling pathway
    109685138 (Ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109685138 (Ptgs2)
   04657 IL-17 signaling pathway
    109685138 (Ptgs2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    109685138 (Ptgs2)
   04913 Ovarian steroidogenesis
    109685138 (Ptgs2)
   04921 Oxytocin signaling pathway
    109685138 (Ptgs2)
  09156 Nervous system
   04726 Serotonergic synapse
    109685138 (Ptgs2)
   04723 Retrograde endocannabinoid signaling
    109685138 (Ptgs2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    109685138 (Ptgs2)
   05206 MicroRNAs in cancer
    109685138 (Ptgs2)
   05204 Chemical carcinogenesis
    109685138 (Ptgs2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    109685138 (Ptgs2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    109685138 (Ptgs2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109685138 (Ptgs2)
   05165 Human papillomavirus infection
    109685138 (Ptgs2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    109685138 (Ptgs2)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109685138 (Ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 109685138
NCBI-ProteinID: XP_020017438
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MRPASRAPRPAMLARALLLSVVLALSAAANPCCSNPCQNRGECMSIGFDQYECDCTRTGF
YGENCSTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMKYVLTSRSHL
IDSPPTYNAHYGYKNWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEVLEKVLL
RRKFIPDPQGTNMMFAFFAQHFTHQFFKTDQKQGPAFTKGLGHGVDLSHVYGETLDRQHK
LRLFKDGKMKYQIIDGEVYPPTVKDTQVEMIYPPHIPEHLRFAVGHEVFGLVPGLMMYAT
IWLREHNRVCDVLKQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDP
ELLFNQQFQYQNRIAAEFNTLYHWHPLLPDTFQIDEQEYNFKQFLYNNSILIEHGLTQFV
ESFTRQNAGRVAGGRNVPLAVQTVAKASIDQSREMKYQSLNEYRKRFSLKPYASFEELTG
EKEMAAELEALYGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPQ
YWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFSVQDSQLTKTATINASSSHSRLE
DINPTVLLKERSTEL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctgcgtcccgcgccccacgcccagcgatgctcgcccgcgccctgctgctcagc
gtggtcttggcgctcagcgctgcagcaaatccttgctgttccaacccatgtcaaaaccga
ggggaatgtatgagcataggatttgaccagtacgagtgtgactgtacccggactggattc
tatggagagaactgctccacacctgaatttcttacaagaataaaattgcttctaaagccc
actccaaacacagtacactacatacttacccacttcaagggagtctggaacatcgtcaat
aacattcccttcctgcggaattcaattatgaaatatgtgttgacgtccagatcacatttg
attgacagtccgccaacttacaatgcacactatggctacaaaaattgggaagccttctct
aacctctcctactataccagagcccttcctcctgtagccgacgactgcccaactcccatg
ggggtgaaagggaagaaggagcttcctgattcaaaagaggttctggaaaaagttctccta
agaagaaagttcatccctgacccacaaggcacaaatatgatgtttgcattctttgcccaa
cactttacccatcagtttttcaagacagatcaaaaacaaggacctgcctttaccaaagga
ctgggccatggggtggacttaagtcatgtttatggtgaaaccctagacagacagcacaaa
ctgcgtcttttcaaggatggaaaaatgaaatatcagataattgatggagaggtgtatccc
cccacagtcaaggacactcaggtagagatgatctacccgcctcatatccctgagcatctg
cgatttgccgtggggcatgaggtctttggtctggtgcctggtctcatgatgtatgccaca
atctggttgcgggaacacaacagagtatgtgatgtgcttaaacaggagcaccctgagtgg
gatgatgagcggttattccagactaccaggctcatactgataggagagacgatcaagatt
gtgatcgaagactacgtacagcacttgagcggctatcacttcaaactgaagtttgatcct
gagttgctgttcaaccaacaattccagtaccaaaaccggatcgctgcagagtttaacaca
ctctaccactggcatcctctgctgcctgacaccttccagatagatgagcaggagtacaac
tttaaacagtttctctacaacaactccatcctgatagaacacggacttacccagtttgtg
gagtcgttcaccaggcaaaatgctggcagggtggctggtgggaggaatgttccacttgct
gtacaaacagtggcaaaggcgtccattgaccagagcagagagatgaaataccagtctctg
aacgagtaccgcaaacgcttctcactgaagccctatgcatcgtttgaagaacttacagga
gagaaggaaatggctgcagagctggaagccctttatggtgacattgatgctatggagctc
tatcctgcccttctggtagaaaagcctcgtccagatgctatatttggggagaccatggta
gaaatgggagcaccgttctccttgaaaggccttatgggtaaccccatctgctctcctcaa
tactggaagccgagcacttttgggggagaagtaggttttaaaatcatcaacactgcctca
attcagtctctcatctgcaataacgtgaaaggctgtccttttacttcgttcagtgttcag
gattcccaactcaccaaaacagccaccatcaatgccagctcttcccactccagactggag
gacatcaatcccacagtgctactaaaagaacgttcgacagaattgtag

DBGET integrated database retrieval system