KEGG   Castor canadensis (American beaver): 109685488
Entry
109685488         CDS       T04791                                 

Gene name
Kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04640  Hematopoietic cell lineage
ccan04916  Melanogenesis
ccan05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109685488 (Kitlg)
   04014 Ras signaling pathway
    109685488 (Kitlg)
   04015 Rap1 signaling pathway
    109685488 (Kitlg)
   04072 Phospholipase D signaling pathway
    109685488 (Kitlg)
   04151 PI3K-Akt signaling pathway
    109685488 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109685488 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    109685488 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109685488 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccan04052]
    109685488 (Kitlg)
Cytokines and growth factors [BR:ccan04052]
 Growth factors
  Growth factors (RTK binding)
   109685488 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 109685488
NCBI-ProteinID: XP_020017926
UniProt: A0A250XXE1
LinkDB
Position
Unknown
AA seq 273 aa
MKKTQTWIITCIHLQLLLFNPLVKTEEICGNPVTDNVKDITKLVANLPKDYMITLNYVTG
MDVLPSHCWLQEMVKQLSVSLTNLLDKFSNISEGLSNYSIIDKLGKIVDDLVYCVDNISL
KNVKESSKRPEPRLFTPEEFFRIFNRSIDAFKDFRASSETSDCVLSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAVNSTGDSDLQWAAMALPAFFSLAIGFAFGALYWKKK
QPNLTRAVENRQINEEDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcattcatcttcaactgctcctcttcaat
cctctcgtcaaaactgaagagatctgcgggaatcccgtgactgataatgtaaaagacatc
acaaaattggtggcaaatcttccaaaagactatatgataaccctcaactatgtcaccggg
atggatgttttgcctagtcattgttggttacaggagatggtaaaacaattgtcagtcagc
ctgactaatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgggaaaatagtggatgaccttgtgtattgcgtggataacatctcactt
aagaatgtaaaagaatcatctaagaggccagaacccaggctctttactccagaagaattc
tttagaatttttaatagatccattgatgcctttaaggactttagggcatcatctgaaact
agcgattgtgtgctttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagcagtaaattctactggagactctgacctacaatgggcagccatggcattg
ccagcattcttttctcttgcaattggctttgcttttggagccttatactggaagaagaaa
caaccaaatcttacaagggcagttgaaaatagacagattaatgaagaggataatgagata
agtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system