KEGG   Castor canadensis (American beaver): 109686401Help
Entry
109686401         CDS       T04791                                 

Gene name
Setd1b
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109686401 (Setd1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109686401 (Setd1b)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109686401 (Setd1b)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109686401 (Setd1b)
   HMT complexes
    COMPASS/SET1 complex
     109686401 (Setd1b)
    COMPASS/SET1 complex (yeast)
     109686401 (Setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 109686401
NCBI-ProteinID: XP_020019275
LinkDB All DBs
Position
Unknown
AA seq 1961 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGSLSAGCGSGS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPTATFKTRRHESKFTDAYNRRHEHHYVHNSAAAAVPAATATFRSSSDLPFGTAGSSG
GSSGPPFKSQPQDSATFAHTPPPAQAAPAPGFKSAFSPYQTPVPPFPPPPEEPTATATFG
ARDSGEFRRAPAPPPLPPTEPLAKEKPGTPPGPPPPDTNSMELGGRPTFGWSPEPCDSPG
TPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSSQLS
PLAPFGTNSQPGFRGPSPPSSRPSSTGLEDISPTPLPDSDEDDELDLCLGPRPPPEPGPP
DPISLLGQATDVALDLAGDRTPTSEKMDEGHQSSGEDMEISDDEMPSAPITSADCPKPMV
VTPGSGAAPNVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPPSHPAV
TVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLS
RLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPSRGQPWPPLPKFDPS
VPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERM
AKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFK
VKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDSKGVGVRRRP
ARPLELDSGGEEDEKESLSVSSSSSSSSSGSSTTSPSSSASDKEEERESTEEEEAEEEEE
EEEEEGPRSQVSSSSTSSTSDKDDDEDSDEQDESENDGQDAVLSGASEKDDGESDGEETV
SIATSKAVAESSSESSESSEFESSSESESESSSSEDEDEMAAEEEEEEEEEEEEAVAAVT
DESMPPAGAKDLEQDDAEVPLAPGAPAVESLGTEEEVDIEVEEEAPEEQTSILEEPPLPV
GVEELEGCKEPPEEPSPSQEGAMMLSPEPPARETEAQPPSSPEHVPEEDLEEEPEPPPML
SLPLQPPLPPPRPPRPPSPPPEPETSEPPPEDQPPRTPGLCGSLAKSQSTETVPATPGGE
PPLSGGSSGLSLSSPQVPGSPFSYPSQSPGLSSGGLPRTPGRDFSFTPTFPEPSGPLLLP
VCPLPAGRRDERSGPXASPVLLETGLPLPLPLPLPLPLALPVPVLRAQARAPAQLPPLLP
APLAPCPPPIKRKPGRPRRSPPSMLSLDGPLVRPPAGAALGRDLLLLPGQPQTPIFPSTH
DPRAVTLDFRNTGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELDNQWPSEAIPPGPRGR
DDVTEEYMELAKARGPWRRPPKKRHEDLVATSASPELSPPQPLFRPRSEFEEMTILYDIW
NGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTG
CARSEGFYTIDKKDKLRYLNSSRTSTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRLL
SSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVI
ADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKI
VIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5886 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccacagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccagctctg
aaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagtctggcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccgcgggtcgtcgggatctggaccaaaaac
aaggagctggagctgtcggtgcccaaattcaagatcgatgagttctatgtgggcccagtg
cctccaaagcaggtgacatttgccaagctgaatgataacatccgcgaaaacttcctgagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccccaagacc
aagaagcacctgggcattgccaaggtggtcttcgccacggtcaggggagccaaggaagcc
gtccagcacttgcacagcacttccgttatgggtaacatcatccacgtggagctggacacc
aaaggggaaactcgaatgcgcttctacgaactgttggtcactggtcgatacaccccccag
accctcccagtgggtgagctggatgctgtttctccaatagtgaatgagaccctacagctg
tcagatgccctgaagcgcctcaaggatggcagcctgtctgcaggctgtggctctggctcc
tcctctgtcacccccaatagtggtgggacaccgttctcccaggacacggcttactccagc
tgccgcctggacacaccgaactcctacggacagggcaccccactcacaccacgcctgggc
acccccttctcacaggactccagctactctagccgacagcccacgccctcctacctcttt
agccaggaccccacggcaaccttcaagactcggcggcatgagagcaagttcacggacgcc
tacaaccgccgccatgagcaccactatgtccacaactctgcagctgcagcagtgccagcg
gccacagccaccttccgcagctcctcagacctcccatttggaacagctggcagcagtggg
ggcagcagtggccctcccttcaagtctcaaccacaggattcggccacatttgcccacact
ccaccacctgcccaagcagcccctgctcccggattcaagtccgctttctctccataccag
accccagtacccccctttcctccacccccagaggagccaactgccacagccacctttggg
gctcgtgacagcggggagttccggagggcgcctgcacccccacccctgccacccactgag
cccttggccaaggagaagcccggaacgccccctggcccgccaccccctgacaccaacagc
atggagctgggtggccggcccacctttggctggagtcctgaaccctgtgacagcccaggt
acacctacattggagtcctcgcctgcagggccagagaagccccacgacagcctggattca
cgtattgaaatgctgcttaaggagcagcgcaccaagctacccttcctacgggagcaggac
tcggacaccgagctgcaaatggaagggagccccatctcctcctcttcctcccagctctcc
ccacttgccccctttggcaccaattcccagcctggcttccgtggtccctcgccaccctcc
tcacgcccctccagcacaggcctggaggacatcagtccaacgccactgcctgactctgac
gaggacgatgagctggacctgtgcctggggcctcggcccccacctgagccaggtcccccg
gatcctatcagtcttctaggccaggcaactgatgtggccttggacctggctggagacagg
accccaacctcagagaagatggatgagggccaccagtcctcaggcgaggacatggagatc
tcggatgatgagatgccctcagctcccatcaccagcgccgactgccccaagcccatggtg
gtgaccccagggtcaggggcagcccctaatgtgttggcgccaactctgcccctaccccca
ccacccggcttcccaccgctgcccccgcccccgcctccacccccaccccagcctggcttc
cccatgcccccacctttgcccccaccaccgcccccacccccaccatcccaccctgctgtg
acagtgcccccaccacccctgccagcaccacctggcgtcccacctccacccatcctgcca
ccattgccacccttcccgccaggactatttcccgtgatgcaggtggacatgagccacgtg
ctgggcggccagtggggtggcatgcccatgtccttccagatgcaaacacagatgctaagc
cggctaatgacaggccagggcgcttgcccatacccacccttcatggctgccgcagctgcg
gccgcttcagctgggctgcagtttgtcaacctaccgccctaccggggccccttctccttg
agcaacagtggcccaagccgtgggcaaccctggccacctttgcccaagtttgacccctca
gtgccgccaccaggctatgtgccacgtcaggaggacccacacaaggccacagtagatggc
gtcctgctggtagtgctcaaggagctcaaggccatcatgaagcgtgacctgaaccgcaag
atggtggaggtggtggccttccgtgccttcgatgagtggtgggacaagaaggagcggatg
gccaaggcatcactgacccctgtaaagtcaggcgagcacaaggatgaagacaggccaaag
cccaaggaccgcattgcctcctgcctgctggagtcatggggcaagggcgagggtttgggc
tatgaagggctgggcttgggcatcggcctgcgtggggccatccgcctgccctccttcaag
gtcaagaggaaggagccaccagacacggcttcttctggtgaccaaaaacgtctgcggcct
tcaacatctgtggatgaggaagacgaagagtctgagcgggagcgggaccgggacatggca
gacgccccctgcgagcttgccaagcgggactccaagggcgtgggcgtgcgacggaggcct
gctcggcccctagaactggacagtgggggagaagaagatgagaaggagtccttatctgtg
tcttcgtcctcgtcatcctcatcctcgggatcctccaccacctcaccttcatcctcagcc
tcagacaaagaggaggagcgtgaaagcactgaagaggaagaagcagaggaagaggaggag
gaggaagaggaggaaggccccaggagtcaggtctcctcctcctcgacctcgtccacatca
gataaggatgacgatgaagacagtgatgagcaggatgagtctgagaacgatggccaagac
gcagtcttatcaggggcgagtgagaaagatgacggagagtcagatggagaagagacagtg
agcatcgccacctccaaggctgtggccgagtcatccagtgagagttctgagtcttctgag
tttgagtcaagctctgagtcggaatctgagtcctcatcctcagaggatgaagatgagatg
gcagcagaagaagaggaggaagaggaggaggaggaagaagaggcagtggcagcagtgaca
gatgagagcatgcctcctgcaggcgccaaggaccttgagcaagatgatgcagaagtgcct
ctggccccaggggcacctgcagttgagtccttgggcacagaggaggaggtagacattgaa
gttgaggaggaagcccctgaggagcaaacctccatcctggaagaaccccctttgcctgtg
ggtgttgaagagctagaggggtgcaaggagccccctgaagagccaagcccgagccaggaa
ggggccatgatgctgtctccagaaccccctgccagggagacagaagctcagcccccatca
tcccctgaacatgttccagaggaagacctggaagaggagcccgaaccccctccgatgctc
tccttgcctctgcagccaccattgccaccaccccggccaccccggccacccagcccacca
cccgagcctgagacctcggagcctccccctgaagaccagcccccacgtactccaggcctc
tgtggcagcctggccaagtcgcagagcacagagacagtgccggctaccccaggtggggag
cctccactatcaggaggcagcagtggcctatcactgagctccccacaggtgcccggcagc
cccttctcctacccatcccagtcccctggcttgagcagcgggggcctccctcggacacct
ggccgggacttcagcttcacacccaccttccctgagcccagtggacccctgcttctacct
gtctgtcccctcccggctggtaggcgtgatgaacgctctggccccntggcctcccctgtg
ctcctggagacgggcctacctctcccactgcccctacccctgcccctgcccctggcattg
cctgtccctgtcctgagggcccaggctcgggcacctgcccaactgccacccctgctgcct
gcacccctggctccctgcccaccccccatcaagagaaagccgggccggccccggcgatcc
cctccatctatgctgtccttggatgggcccttggtccggccaccagcaggggctgccctt
gggagggacctcctgcttctgccaggccagccacagacccccatcttccccagcacccat
gatccccgggctgttaccctggacttccggaacacagggatcccagcccccccaccgccc
ctcccaccccaaccccctccacccccacctccaccacctgttgagcctaccaagctgccc
tttaaggaactggacaaccagtggccctctgaggccattcccccaggccctcgtgggcgc
gatgatgtcaccgaggaatacatggagctggccaaggcacgggggccatggcgccggcca
cctaagaagcgccatgaggacttggtggccacctcggcctctcctgagctctcaccaccc
cagccccttttccggccccgctcggaatttgaagaaatgaccatcctgtatgacatctgg
aatggtggcatcgatgaggaggacattcgcttcctgtgtgtcacctatgagcggctgctg
cagcaggataacggcatggactggctcaacgacacactctgggtctaccatccctccacc
agcctctcttcagctaaaaaaaagaaacgggatgatggcatccgtgagcatgtgacaggc
tgtgctcgcagtgagggcttctacaccatcgacaagaaggacaagctcagatacctcaac
agcagccgcaccagcaccgacgagccccccgcggacacccagggcatgagcatcccggca
cagccccatgcttctactcgggcaggctccgagcggcgttcagagcagcgccgcctgtta
tcctcctttactggcagctgtgacagtgacctactcaagtttaaccagctcaagttccgg
aagaaaaagctcaaattctgtaagagccacattcatgactggggcctgttcgccatggag
cccatcgcagctgatgagatggtcatcgagtacgtgggccagaacatccgccaggtgatc
gcagatatgagggagaagcgatacgaggatgagggcatcggtagcagctacatgttccga
gtggaccatgataccatcattgacgccaccaagtgtggcaacttcgctcgcttcattaac
cacagctgcaaccccaactgctacgccaaggtgatcacagtggagtcgcagaaaaagatt
gtcatctactcgaagcagcacatcaatgtcaatgaggagatcacatatgactacaagttc
cccattgaggacgtcaagatcccttgcctctgcggctcggagaactgccgggggaccctc
aactag

DBGET integrated database retrieval system