KEGG   Castor canadensis (American beaver): 109686994Help
Entry
109686994         CDS       T04791                                 

Gene name
Camk1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1 isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04020  Calcium signaling pathway
ccan04921  Oxytocin signaling pathway
ccan04925  Aldosterone synthesis and secretion
ccan05214  Glioma
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109686994 (Camk1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109686994 (Camk1)
   04925 Aldosterone synthesis and secretion
    109686994 (Camk1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    109686994 (Camk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109686994 (Camk1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109686994 (Camk1)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   109686994 (Camk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 Tyrosinase
Motif
Other DBs
NCBI-GeneID: 109686994
NCBI-ProteinID: XP_020020184
UniProt: A0A250YGR8
LinkDB All DBs
Position
Unknown
AA seq 370 aa AA seqDB search
MPGAVEGPSWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDARLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGEMLTPTAGGPATGCCCRDCCREAGQ
ELAPTLPPQL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcagtggaaggtcctagctggaagcaggcggaggacattagggacatttat
gacttccgagatgttctgggcacgggggccttttcagaggtaatcctggcagaagataag
aggacgcagaagctggtggccatcaaatgcattgccaagaaggctctggagggcaaagag
ggcagcatggagaatgagattgctgtcctgcacaagatcaagcaccccaacatcgtagcc
ctagatgacatctatgagagtgggggccacctctacctcatcatgcagctggtgtcgggc
ggggagctgtttgaccgtattgtggagaaaggattctacacagagcgggacgccagccgt
ctcatcttccaggtgctggatgctgtcaagtacctgcatgacctgggcattgtgcaccgg
gacctcaagccagaaaatttgctgtactacagcctggatgaagactccaagatcatgatc
tcggactttggcctctccaagatggaggacccaggcagtgtcctctccacagcctgtggg
accccgggatacgtggcccctgaggtcctagctcagaagccctacagcaaggctgtggac
tgctggtccattggagtcatcgcctacattctgctctgcggctacccccccttctatgac
gagaatgatgccagactctttgaacagattctaaaggctgagtacgagtttgactctcct
tactgggatgacatctctgactctgcaaaagattttatccggcacttgatggagaaggat
ccagagaagaggtttacctgtgagcaggccttgcagcacccatggattgcaggagatacg
gctcttgataagaatatccaccagtcagtgagcgagcaaatcaagaagaattttgccaag
agcaagtggaagcaagccttcaatgccacggctgtagtacggcacatgaggaagttgcag
ctgggcaccagtcaggaggggcagggacagacggcaagccacggggagatgctgacaccc
acagctgggggaccagcaactggctgctgttgtcgagactgctgcagggaggcaggtcaa
gaactggccccaacactgccaccccagctctag

DBGET integrated database retrieval system