KEGG   Castor canadensis (American beaver): 109687142
Entry
109687142         CDS       T04791                                 

Gene name
Rela
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01523  Antifolate resistance
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04024  cAMP signaling pathway
ccan04062  Chemokine signaling pathway
ccan04064  NF-kappa B signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04071  Sphingolipid signaling pathway
ccan04137  Mitophagy - animal
ccan04151  PI3K-Akt signaling pathway
ccan04210  Apoptosis
ccan04211  Longevity regulating pathway
ccan04218  Cellular senescence
ccan04380  Osteoclast differentiation
ccan04620  Toll-like receptor signaling pathway
ccan04621  NOD-like receptor signaling pathway
ccan04622  RIG-I-like receptor signaling pathway
ccan04623  Cytosolic DNA-sensing pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04657  IL-17 signaling pathway
ccan04658  Th1 and Th2 cell differentiation
ccan04659  Th17 cell differentiation
ccan04660  T cell receptor signaling pathway
ccan04662  B cell receptor signaling pathway
ccan04668  TNF signaling pathway
ccan04722  Neurotrophin signaling pathway
ccan04917  Prolactin signaling pathway
ccan04920  Adipocytokine signaling pathway
ccan04926  Relaxin signaling pathway
ccan04931  Insulin resistance
ccan04932  Non-alcoholic fatty liver disease
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan05010  Alzheimer disease
ccan05022  Pathways of neurodegeneration - multiple diseases
ccan05030  Cocaine addiction
ccan05132  Salmonella infection
ccan05133  Pertussis
ccan05134  Legionellosis
ccan05135  Yersinia infection
ccan05140  Leishmaniasis
ccan05142  Chagas disease
ccan05145  Toxoplasmosis
ccan05146  Amoebiasis
ccan05152  Tuberculosis
ccan05160  Hepatitis C
ccan05161  Hepatitis B
ccan05162  Measles
ccan05163  Human cytomegalovirus infection
ccan05164  Influenza A
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05168  Herpes simplex virus 1 infection
ccan05169  Epstein-Barr virus infection
ccan05170  Human immunodeficiency virus 1 infection
ccan05200  Pathways in cancer
ccan05202  Transcriptional misregulation in cancer
ccan05203  Viral carcinogenesis
ccan05212  Pancreatic cancer
ccan05215  Prostate cancer
ccan05220  Chronic myeloid leukemia
ccan05221  Acute myeloid leukemia
ccan05222  Small cell lung cancer
ccan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccan05321  Inflammatory bowel disease
ccan05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109687142 (Rela)
   04014 Ras signaling pathway
    109687142 (Rela)
   04064 NF-kappa B signaling pathway
    109687142 (Rela)
   04668 TNF signaling pathway
    109687142 (Rela)
   04066 HIF-1 signaling pathway
    109687142 (Rela)
   04071 Sphingolipid signaling pathway
    109687142 (Rela)
   04024 cAMP signaling pathway
    109687142 (Rela)
   04151 PI3K-Akt signaling pathway
    109687142 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109687142 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    109687142 (Rela)
   04218 Cellular senescence
    109687142 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109687142 (Rela)
   04621 NOD-like receptor signaling pathway
    109687142 (Rela)
   04622 RIG-I-like receptor signaling pathway
    109687142 (Rela)
   04623 Cytosolic DNA-sensing pathway
    109687142 (Rela)
   04625 C-type lectin receptor signaling pathway
    109687142 (Rela)
   04660 T cell receptor signaling pathway
    109687142 (Rela)
   04658 Th1 and Th2 cell differentiation
    109687142 (Rela)
   04659 Th17 cell differentiation
    109687142 (Rela)
   04657 IL-17 signaling pathway
    109687142 (Rela)
   04662 B cell receptor signaling pathway
    109687142 (Rela)
   04062 Chemokine signaling pathway
    109687142 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109687142 (Rela)
   04917 Prolactin signaling pathway
    109687142 (Rela)
   04926 Relaxin signaling pathway
    109687142 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109687142 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109687142 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    109687142 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109687142 (Rela)
   05202 Transcriptional misregulation in cancer
    109687142 (Rela)
   05203 Viral carcinogenesis
    109687142 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109687142 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109687142 (Rela)
   05221 Acute myeloid leukemia
    109687142 (Rela)
   05220 Chronic myeloid leukemia
    109687142 (Rela)
   05215 Prostate cancer
    109687142 (Rela)
   05222 Small cell lung cancer
    109687142 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109687142 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109687142 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    109687142 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    109687142 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109687142 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109687142 (Rela)
   04931 Insulin resistance
    109687142 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109687142 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109687142 (Rela)
   05135 Yersinia infection
    109687142 (Rela)
   05133 Pertussis
    109687142 (Rela)
   05134 Legionellosis
    109687142 (Rela)
   05152 Tuberculosis
    109687142 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109687142 (Rela)
   05170 Human immunodeficiency virus 1 infection
    109687142 (Rela)
   05162 Measles
    109687142 (Rela)
   05164 Influenza A
    109687142 (Rela)
   05161 Hepatitis B
    109687142 (Rela)
   05160 Hepatitis C
    109687142 (Rela)
   05168 Herpes simplex virus 1 infection
    109687142 (Rela)
   05163 Human cytomegalovirus infection
    109687142 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109687142 (Rela)
   05169 Epstein-Barr virus infection
    109687142 (Rela)
   05165 Human papillomavirus infection
    109687142 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109687142 (Rela)
   05145 Toxoplasmosis
    109687142 (Rela)
   05140 Leishmaniasis
    109687142 (Rela)
   05142 Chagas disease
    109687142 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109687142 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccan03000]
    109687142 (Rela)
Transcription factors [BR:ccan03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109687142 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 109687142
NCBI-ProteinID: XP_020020480
LinkDB
Position
Unknown
AA seq 578 aa
MAALGSAGPWREPPPRCLLPPFCAARCCAGSGRPDDLFPLIFPSAEPAQASGPYVEIIEQ
PKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPH
PHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIE
EQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSC
LGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPGLQAPV
RVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRP
PSRRIAVPSRSSASIPKPAPQPYAFTPSLSTINFDEFTPMVLPAGQIPSQASALAPAPAP
VLAQTLIPAQAMAPAPVPVLAPGPSQAVAPPAPKTTQPGEGTLSEALLHLQFDADEDLGA
LLGNSTDPAVFTDLASVDNSEFQQLLNQGVSMPHPTAEPMLMEYPEAITRLVTGSQRPPD
PAPTPLGVPGLPNGLSGDEDFSSIADMDFSALLSQISS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggccgctctcggatctgcggggccgtggcgggagccccccccgcgctgccttctgccc
cctttctgcgccgcgaggtgctgcgcagggagcggccggccggatgatctcttccccctc
atcttcccctcagcagagccagcccaagcttctggtccctatgtggagatcatcgagcag
cccaagcagcgcggcatgcgcttccgctacaagtgtgaggggcgctcagcaggcagtatc
ccaggcgagaggagcacggataccaccaagacacaccccactatcaagatcaatggctat
acaggaccagggacagttcgcatctctttggtcaccaaggatccccctcaccggcctcac
ccccatgagcttgtggggaaagactgccgggatggcttctatgaggctgagctctgtcca
gaccgctgcatccacagcttccagaatctggggatccaatgtgtgaagaagcgggacctg
gagcaagcgatcagccagcgcatccagaccaacaacaaccccttccaagttcccatagaa
gagcagcgtggggactatgacctgaatgctgtgcggctctgcttccaggtgacagtgcgg
gacccatcaggcaggccccttcgcctgccacctgtcctctctcatcctatctttgacaac
cgtgcccccaacactgcagaactcaagatctgccgagtgaaccgaaactctgggagctgt
cttggtggggatgagatcttcctgctgtgtgacaaggtgcagaaagaggacattgaagtg
tatttcacgggaccgggctgggaggcccgaggctccttttctcaagctgatgtgcaccga
caagtggccattgtgttccggacccctccctatgcggaccccggcctgcaggctcctgtg
cgtgtttccatgcagctgcggcggccttctgaccgggagctcagtgagcccatggagttc
cagtacttgccagacacagatgatcgccaccggattgaggagaaacgcaaaagaacatac
gagaccttcaaaagcatcatgaagaagagtcctttcaatggacctactgatccgcggcct
ccatcccggcgcattgctgtcccttcccgaagttcagcttccatccccaagccagccccc
caaccctatgcctttacaccatccctcagcaccatcaactttgatgagtttacccccatg
gtgttacctgctgggcagatcccaagccaggcctcagccttggcaccagctcctgcccca
gtcctggcccagaccttgatccctgcacaagccatggcaccagcccctgttccagtccta
gccccaggcccttcccaggctgtggccccacctgccccaaagaccacccagcctggggaa
ggcacactgtcggaggccctgctacacctgcagtttgacgctgatgaagacctgggagct
ttgcttggcaacagcacagacccagctgtgttcacagacctggcatccgttgacaactca
gagtttcagcagctgctgaaccagggtgtatccatgcctcaccccacagctgagcccatg
ctgatggagtaccccgaggctataactcgcctggtaacagggtcccagaggccccctgac
ccagctcccaccccactgggggtcccagggctccccaatggcctctcaggggacgaagac
ttctcctccattgcggacatggacttctcggcccttttgagtcagatcagctcctaa

DBGET integrated database retrieval system