KEGG   Castor canadensis (American beaver): 109687178
Entry
109687178         CDS       T04791                                 

Gene name
Lpar2
Definition
(RefSeq) LOW QUALITY PROTEIN: lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04015  Rap1 signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04080  Neuroactive ligand-receptor interaction
ccan04151  PI3K-Akt signaling pathway
ccan04810  Regulation of actin cytoskeleton
ccan05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109687178 (Lpar2)
   04072 Phospholipase D signaling pathway
    109687178 (Lpar2)
   04151 PI3K-Akt signaling pathway
    109687178 (Lpar2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109687178 (Lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109687178 (Lpar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109687178 (Lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ccan04030]
    109687178 (Lpar2)
G protein-coupled receptors [BR:ccan04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109687178 (Lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 109687178
NCBI-ProteinID: XP_020020567
LinkDB
Position
Unknown
AA seq 351 aa
MVTMGQCYQNETISFFYNNSGKELSSHWRPKDVVVVTLGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGXAYLFLMFHTGPRTARLSLNGWFLRQGLLDTSLTASMA
TLLAIAVERHRSVMAVQLHSRLPRGRVVALIVVVWVAALGLGLLPAHFWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFVLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAESNSLVNAVVYSCRDA
EMRRTFRRLLCCLCLRWSPHKAARYPSSTQTGTSTRIILPENGHPLMDSTL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggtcaccatgggccagtgctaccagaatgagaccatcagctttttctacaacaacagt
ggtaaggagctcagctctcactggcgtcccaaagatgtagtggtggtgacgctggggctg
actgtcagcgtgctggtcctgctcaccaacctgctggtgattgcggccatcgcctccaac
cgccgtttccaccagcccatttactacctgctgggcaacctggccgcggccgacctcttc
gccgggnntgcttacctcttcctcatgttccacacgggcccacgcaccgcccggctgtcg
ctcaacggctggttcctgcgccagggcctgctggacaccagcctcacggcgtcgatggcc
accctgctggccatcgccgtggagcggcaccgcagtgtgatggccgtgcagctgcacagc
cgcctgccccgcggccgggtggtcgcgctcatcgtggtggtgtgggtggccgccctgggc
ctggggctgctgcccgcacacttctggcactgtctctgtgccctggaccgctgctcccgc
atggcgccactgctcagccgctcctacctggccgtgtgggccctgtccagcctgctggtc
tttgtgctcatggtagctgtctacacccgcattttcttctacgtgcgaagacgggtacag
cggatggccgagcatgtcagctgccacccccgctaccgggagaccactctcagcctggtc
aagaccgtcgtcatcatcctgggggcgttcgtggtctgctggactccaggccaggtggta
ctgctgctggatgggctggactgcaagtcctgcaatgtcctggctgtggagaaatatttc
ctgctcttggctgagtccaactcgctggtgaatgccgtggtgtactcctgccgcgacgcc
gagatgcgacgtaccttccgccgtctcctctgctgcctgtgcctccgctggtccccgcac
aaggctgcccgctacccatcctccacccagacaggcaccagcactcgaatcatccttccc
gagaacggccaccccttgatggactccaccctctag

DBGET integrated database retrieval system