KEGG   Castor canadensis (American beaver): 109687337Help
Entry
109687337         CDS       T04791                                 

Gene name
Ezh1
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase EZH1
  KO
K17451  histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109687337 (Ezh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109687337 (Ezh1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109687337 (Ezh1)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109687337 (Ezh1)
   Polycomb group proteins
    PRC2-EZH1 complex
     109687337 (Ezh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 109687337
NCBI-ProteinID: XP_020020769
LinkDB All DBs
Position
Unknown
AA seq 744 aa AA seqDB search
MEEYSKMDIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQ
ILNEEWKKLRVQPVQSMKPCTIESIFPGFTSQHMLMRSLNTVALVPIMYSWSPLQQNFMV
EDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDAL
NQYSDEXEEGHNDTSDGKQDDSKEDLPVTRKRKRHTIEGNKKSSKKQFPNDMIFSAIASM
FPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCRRCF
KYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAKLHNPRSKCSGRRRR
RHHVVSASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPPQLC
VVEAPSESVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPT
DELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMTQNF
CEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCK
NCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYM
SSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEEL
FFDYRYSQADALKYVGIERETDVL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtacagcaaaatggatataccaaatcccccaacctccaaatgcatcacttac
tggaaaagaaaagtgaaatctgaatacatgcgacttcgacaacttaaacggcttcaggca
aatatgggtgcaaaggccctgtatgtggcaaattttgcaaaggtccaagaaaaaacccag
atccttaatgaagaatggaagaaacttcgtgttcagcctgttcagtcaatgaagccttgt
accatagagagcattttcccggggttcaccagccaacatatgctaatgaggtctctgaac
accgttgcattggttcccatcatgtattcctggtcccccctccagcagaattttatggta
gaagatgagacggttttgtgcaatattccctacatgggagatgaagtgaaagaagaagat
gaaactttcattgaggagttgatcaataactatgatggaaaagtccatggtgaagaagaa
atgatcccaggatctgtcctgattagtgatgctgttttcctggaattggtagatgctctg
aatcaatactcagatgagngagaagaagggcacaatgatacttcagatggaaagcaggat
gacagcaaagaagatctgccagtaacaagaaagagaaagcgacatactattgaaggcaac
aaaaagagttccaagaaacaattcccaaatgacatgatcttcagtgcaattgcctccatg
ttccctgagaatggtgtcccagatgacatgaaggagaggtatcgagagctaacagagatg
tcagaccccaatgcacttccccctcagtgcacacccaacatcgatggccccaatgccaag
tctgtgcagcgggagcaatctctgcactccttccacacacttttttgccggcgctgcttt
aaatacgactgcttccttcacccttttcatgccacccctaatgtatataaacgcaagaac
aaagaaatcaagattgaaccagaaccatgtggcacagactgcttccttttgctggaaggg
gcaaaggagtatgccaaactccataatccccgctccaagtgctctgggcgtcgccggcga
aggcaccatgtggtcagtgcttcctgctccaatacttcagcctctgctgtggctgagact
aaagaaggggacagtgacagagacaccggcaatgactgggcctccagttcttcagaggct
aattctcgctgtcagacccccacaaaacagaaagccagtccagccccacctcagctgtgt
gttgtggaagccccctcggaatctgttgagtggactggggctgaagaatcgctttttcga
gtcttccatggcacctatttcaacaacttctgttcaatagccaggcttctggggacaaag
acatgcaagcaggtctttcagtttgcagtcaaagaatcacttatcctgaagctgccaaca
gatgagctcatgaacccatcacagaagaagaaaagaaagcacagattgtgggctgcacac
tgcaggaaaattcaactgaagaaagataactcttctacacaagtgtataactaccaaccc
tgcgaccacccagaccgtccctgtgacagcacctgcccctgcatcatgactcagaatttc
tgtgagaagttctgccagtgcaacccagactgtcagaatcgtttccctggctgtcgctgt
aagacccaatgcaataccaagcagtgtccttgctatctggcagtgcgagaatgtgaccct
gacctgtgcctcacctgtggggcctcagagcactgggactgcaaggtggtctcctgcaaa
aattgcagcatccagcgtggtctcaagaagcacctgctgctggctccctccgatgtggcc
ggatggggcaccttcattaaggagtctgtgcagaagaacgaattcatttctgaatattgt
ggtgagctcatctctcaggatgaagctgatcggcgagggaaggtctatgacaaatacatg
tccagcttcctcttcaacctcaacaatgactttgtagtagatgctacccggaaaggaaac
aaaattcgatttgcaaaccattcagtgaaccccaactgttatgccaaagtggtcatggtg
aatggagatcatcgcattgggatctttgccaagagggcaattcaggctggcgaagagctc
ttctttgactataggtacagccaagccgatgccctcaagtacgtggggatcgagagagaa
acagacgtcctctag

DBGET integrated database retrieval system