KEGG   Castor canadensis (American beaver): 109687895
Entry
109687895         CDS       T04791                                 

Gene name
Nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109687895 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccan03000]
    109687895 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ccan03310]
    109687895 (Nr3c1)
Transcription factors [BR:ccan03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109687895 (Nr3c1)
Nuclear receptors [BR:ccan03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109687895 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 109687895
NCBI-ProteinID: XP_020021605
LinkDB
Position
Unknown
AA seq 777 aa
MDPKESLAPPSREEVPSSVLGLEKGNVMDFCKTLRGGAVVKGSASSPLLATASQTDSKQQ
RLSVDFPKGSVSNVQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNRSSSVPDNPKSSASAAVSDASTEKEFLQTHSDVSSEQKNLKGQSGTSVG
NVKLCTTDQSTFDIFQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDPFPLEG
DASEDCKPLILPDTKPKIKDNGNIILPNPSSVPLPHVKTEKEDFIELCTPGVIKQEKLGP
VYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQDQKPVFNVIPPISVG
SENWNRCQGSGDDNLTSLGTMNFPSRSVFSNGYSSPGMRPDVSSPPSSSSTATGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQAATGVSQDTSENPANKTVVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSNGGFLCFAPDLIIDEQRMSLPCMYDQCKHMLFVSSELRRLQVSY
EEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLGYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggaccccaaagaatcattagctcccccaagtagagaagaagtccccagcagtgtactt
ggcctggagaagggaaatgtcatggacttctgtaaaaccctaaggggaggagctgttgtg
aagggttctgcatcttcacccttactggctactgcctctcagacagactccaagcaacaa
agactgtcggttgattttccaaaaggctcagtaagcaatgtgcaacagccagatctgtcc
aaagcagtttcgctctcaatgggactgtatatgggagagacagaaacaaaagtgatggga
aatgacctgggatttccacagcagggccaaatcagcctttcctctggggaaacagacttt
cgacttctggaagaaagtattgcaaaccttaataggtcatccagtgttccagacaacccc
aagagttcagcatctgctgctgtgtctgatgcctccacagagaaggagtttctccaaaca
cactctgatgtatcttcagaacagaaaaatcttaaaggccagtctggcaccagtgttggc
aatgtgaaattgtgtaccacagaccaaagcacctttgacatttttcaggatttggagttt
tcttctgggtccccaggtaaagagacaaacgagagtccttggagatcagacctattgata
gatgaaaactgtttgctttctcctttggcaggagaagatgatccattccctttggaagga
gatgcgagtgaggactgtaagcctctcattttaccggacactaaacctaaaattaaggat
aatggaaatataatcttaccaaaccccagcagtgtaccactgccccatgtgaaaacagaa
aaagaagatttcattgaactctgcacccctggggtaattaagcaagagaaactgggccca
gtttactgtcaggcaagcttttctggggcaaatataattggtaataaaatgtctgccatt
tctgttcatggcgtgagtacctctggaggacagatgtaccactatgacatgaatacagca
tccctttctcagcaagatcagaagcctgtttttaatgtcattccaccaatttctgttggt
tctgaaaattggaataggtgccaaggatctggagatgacaacctcacttccttggggact
atgaacttccctagcagatcagttttttctaatggctattcaagccctggaatgagacca
gatgtaagctctcctccatccagctcttcaacagcaacgggaccacctcccaaactctgc
cttgtgtgctctgatgaagcttcgggatgtcattatggggtcttgacctgtggaagctgt
aaagtattcttcaaaagagcagtggaaggtaggcagcacaattacctttgtgctggaaga
aatgattgtatcattgataaaatccgaagaaagaactgcccagcatgtcgctaccggaaa
tgccttcaagctggaatgaacctagaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaagccgctacaggagtctcacaagacacttctgaaaatcctgctaacaaaacagta
gttcctgccacattaccacaactcacccctaccttggtgtcactgttagaggtcattgaa
cctgaggtgttgtatgcaggatatgacagctctgttccagattctacttggaggatcatg
accacactcaacatgttaggtgggcgccaagtgattgcagcagtgaaatgggcaaaggca
ataccaggattcaggaacttacacctggatgaccaaatgacccttcttcagtactcatgg
atgtttctcatggcctttgccctgggctggagatcatacagacaatcaaatggaggtttt
ctgtgttttgctcctgatctgattatagatgagcagagaatgagtctaccctgcatgtat
gaccaatgtaaacatatgctgtttgtctcctctgagttacgaagacttcaggtatcttac
gaagaatatctgtgcatgaaaaccttactacttctctcttcagttcctaaggaaggtttg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaaaagggaaggaaactccagtcaaaactggcaacgattttatcaactgacaaaa
cttttggactccatgcatgaagtggttgaaaatcttcttggctattgcttccaaacattt
ttggataagactatgagtattgaattcccagagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaagtggaaatataaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system