KEGG   Castor canadensis (American beaver): 109688754
Entry
109688754         CDS       T04791                                 

Gene name
Il3ra
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04060  Cytokine-cytokine receptor interaction
ccan04151  PI3K-Akt signaling pathway
ccan04210  Apoptosis
ccan04630  JAK-STAT signaling pathway
ccan04640  Hematopoietic cell lineage
ccan05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109688754 (Il3ra)
   04151 PI3K-Akt signaling pathway
    109688754 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109688754 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109688754 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109688754 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109688754 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ccan04050]
    109688754 (Il3ra)
   04090 CD molecules [BR:ccan04090]
    109688754 (Il3ra)
Cytokine receptors [BR:ccan04050]
 Interleukin receptor families
  IL3 receptor family
   109688754 (Il3ra)
CD molecules [BR:ccan04090]
 Proteins
  109688754 (Il3ra)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 109688754
NCBI-ProteinID: XP_020022880
LinkDB
Position
Unknown
AA seq 404 aa
MPFLWLPVFGMLVTGLLQTPKDAKPPITNLRMEPKYKRLTWELSGNVSDVWCLKGGTHKK
RANDNRYCQYLTLSLCKVTNYTVQVGHPPFSAWILFPEPDKNPEAAAANLSCRVHDVDFV
TCHWAVGKVASGDSVQYQLFWMDKYVCQVHFQGRGGWLLTDPQNLVTCHRDNMEHECPRY
SKNEHGVHVQCHFYNVTKYPQSFKVMVRGISQGHTVSCTQFHQNMNYYEVLSPPNVTADC
NKSHSFMMWQMFSHFTKDFEYDLHILKESQSGKNKNPEVFTAKDIKTEFYTLPNPGAYTV
QIRVRADLLNLASAWSTPKRFVCDTDEDKRTRVWRTALLVALGTLVMALGTFFFCKKCSL
PQKLFPPIPKMKDPIGDNPHDDMMAWEAAQDDCPVTQLQILAEK
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcccttcctgtggctccctgtgttcgggatgctggtgactggactgctgcaaaccccg
aaagatgcgaagccccccatcacgaacttgaggatggaacccaagtataaaagactgact
tgggagctgagcgggaatgtctctgacgtttggtgccttaaaggtggcacgcacaagaaa
cgggcaaacgacaacaggtactgtcaatacctcacgctgtccctctgcaaagtgacaaat
tacaccgtccaagttggccacccgccgttctcagcctggatcctcttccctgaacccgat
aagaacccggaggcggcagctgcaaacctgagctgcagggtgcacgacgtagactttgtc
acctgtcactgggccgtgggcaaggtggcctccggcgacagtgtccagtaccagcttttc
tggatggacaagtatgtgtgccaagtccacttccagggaaggggggggtggctgctcact
gacccccaaaatcttgtcacctgtcacagggacaatatggagcacgagtgtccacgttac
agcaagaatgagcacggggtgcatgtccagtgtcatttttacaatgtcacgaagtatccc
cagagtttcaaggtcatggtgagggggatcagccaagggcacaccgtctcctgcacacag
ttccaccaaaatatgaactactacgaggtgctaagtccaccaaatgtcaccgcagactgc
aataagagtcactccttcatgatgtggcaaatgttcagccatttcacaaaggacttcgag
tacgaccttcacatcctcaaggaatcgcaatctggtaaaaataagaaccccgaagtcttc
acagcaaaagacatcaaaaccgaattctacaccctacccaaccccggagcctacacagtg
cagatccgcgtcagggcagatcttctgaacctggccagcgcctggagcaccccgaaaagg
ttcgtgtgtgacacggatgaggataagcgcacacgtgtgtggcggacagctctgctggtg
gccctggggactctggtcatggcgctggggacatttttcttctgcaagaagtgctcttta
cctcagaagctgttccccccgatcccaaaaatgaaggaccccatcggtgacaaccctcat
gatgatatgatggcctgggaggctgcccaagatgactgcccagtgacacaattgcaaatt
ttagcagaaaaatga

DBGET integrated database retrieval system