Castor canadensis (American beaver): 109688840 Help Entry 109688840         CDS       T04791                                  Name (RefSeq) glutathione S-transferase Mu 4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism ccan  Castor canadensis (American beaver) Pathway ccan00480   Glutathione metabolism ccan00980   Metabolism of xenobiotics by cytochrome P450 ccan00982   Drug metabolism - cytochrome P450 ccan00983   Drug metabolism - other enzymes ccan01100   Metabolic pathways ccan01524   Platinum drug resistance ccan05200   Pathways in cancer ccan05204   Chemical carcinogenesis - DNA adducts ccan05207   Chemical carcinogenesis - receptor activation ccan05208   Chemical carcinogenesis - reactive oxygen species ccan05225   Hepatocellular carcinoma ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     109688840   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     109688840    00982 Drug metabolism - cytochrome P450     109688840    00983 Drug metabolism - other enzymes     109688840  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109688840    05204 Chemical carcinogenesis - DNA adducts     109688840    05207 Chemical carcinogenesis - receptor activation     109688840    05208 Chemical carcinogenesis - reactive oxygen species     109688840   09162 Cancer: specific types    05225 Hepatocellular carcinoma     109688840   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109688840   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109688840  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccan02000]     109688840 Enzymes [BR:ccan01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      109688840 Transporters [BR:ccan02000]  Other transporters   Pores ion channels [TC:1]    109688840 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_N_3 GST_C_6 GST_N_2 GST_C_2 Motif Other DBs NCBI-GeneID:  109688840 NCBI-ProteinID:  XP_020022998 UniProt:  A0A8C0XLM2 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MAMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDYDRSQWLSEKFTLGLDFPNL PYLIDGARKITQSNAILRYIARKHDLCGQTEEEKIHEDILENQLMDVSNDLARVCYSPDF EKLKPEYLEQLPGMMKLFSEFLGKRQWFVGNKITFVDFLAYDVLDLHRIFEPKCLDAFPN LRDFLSRFEGLKKISAYIKTNRFLPKPLYTKVATWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atggccatgacactgggttactgggacatccgcgggctggctcatgccattcgcctgctc ctggagtacacagactcaagctatgaggagaagagatacactatgggggacgctcccgac tatgacagaagccagtggctgagtgagaaattcacactgggcctggacttccccaatctg ccctacttaatcgatggggctcgcaagatcacgcagagcaacgccatcttgcgctacatt gcccgcaagcacgacctgtgtgggcagacagaagaggagaagattcatgaggacattttg gagaaccagctgatggatgtctctaatgatctggccagagtctgctacagccctgacttt gagaaactaaagccagagtacctggagcaactccctggaatgatgaagcttttctcagag ttcctggggaaacgtcagtggtttgttggtaacaagatcacctttgtggattttctggct tatgatgtcctagaccttcaccgtatatttgaacccaagtgcctggatgcgttcccaaac ctgagggactttctgtcccgctttgagggcctgaagaagatctctgcctacataaagacc aaccgcttcctcccaaaacctttgtatacaaaggtggccacatggggcaacaaatag

DBGET integrated database retrieval system