KEGG   Castor canadensis (American beaver): 109689440Help
Entry
109689440         CDS       T04791                                 

Gene name
Pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00562  Inositol phosphate metabolism
ccan01100  Metabolic pathways
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan04068  FoxO signaling pathway
ccan04070  Phosphatidylinositol signaling system
ccan04071  Sphingolipid signaling pathway
ccan04115  p53 signaling pathway
ccan04140  Autophagy - animal
ccan04150  mTOR signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04218  Cellular senescence
ccan04510  Focal adhesion
ccan04931  Insulin resistance
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05200  Pathways in cancer
ccan05206  MicroRNAs in cancer
ccan05213  Endometrial cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05218  Melanoma
ccan05222  Small cell lung cancer
ccan05224  Breast cancer
ccan05225  Hepatocellular carcinoma
ccan05230  Central carbon metabolism in cancer
ccan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109689440 (Pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109689440 (Pten)
   04070 Phosphatidylinositol signaling system
    109689440 (Pten)
   04071 Sphingolipid signaling pathway
    109689440 (Pten)
   04151 PI3K-Akt signaling pathway
    109689440 (Pten)
   04150 mTOR signaling pathway
    109689440 (Pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109689440 (Pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109689440 (Pten)
   04218 Cellular senescence
    109689440 (Pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109689440 (Pten)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109689440 (Pten)
   05206 MicroRNAs in cancer
    109689440 (Pten)
   05230 Central carbon metabolism in cancer
    109689440 (Pten)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109689440 (Pten)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109689440 (Pten)
   05214 Glioma
    109689440 (Pten)
   05218 Melanoma
    109689440 (Pten)
   05215 Prostate cancer
    109689440 (Pten)
   05213 Endometrial cancer
    109689440 (Pten)
   05224 Breast cancer
    109689440 (Pten)
   05222 Small cell lung cancer
    109689440 (Pten)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109689440 (Pten)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109689440 (Pten)
   05165 Human papillomavirus infection
    109689440 (Pten)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109689440 (Pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccan01009]
    109689440 (Pten)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109689440 (Pten)
    3.1.3.48  protein-tyrosine-phosphatase
     109689440 (Pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109689440 (Pten)
Protein phosphatases and associated proteins [BR:ccan01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109689440 (Pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DUF3256
Motif
Other DBs
NCBI-GeneID: 109689440
NCBI-ProteinID: XP_020023881
LinkDB All DBs
Position
Unknown
AA seq 270 aa AA seqDB search
MICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVAL
LFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDI
KVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDK
EYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNE
PDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtgcatatttattacatcggggcaaatttttaaaggcacaagaagccctagat
ttctatggggaagtaaggaccagagataaaaagggagtaactattcccagtcagaggcgc
tatgtgtattattatagctacctgctaaagaatcacctggattatagaccagtggcactg
ttgtttcacaagatgatgtttgaaactattccaatgttcagtggcggaacttgcaatcct
cagtttgtggtctgccagctaaaggtgaagatatattcctccaattcaggacccacacga
cgggaagacaagttcatgtactttgagttccctcagccattgcctgtgtgtggtgacatc
aaagtagagttcttccacaagcagaacaagatgctaaaaaaggataaaatgtttcacttt
tgggtaaatacgttcttcataccaggaccagaggaaacctcagaaaaagtagaaaatgga
agtctatgtgatcaagaaattgatagtatctgcagtatagaacgtgcagataatgacaag
gaatatctagtacttactttaacaaaaaatgacctcgacaaagcaaataaagacaaggcc
aaccgatatttttctccaaattttaaggtgaagctgtacttcacaaaaacagtagaagag
ccatcaaatccagaggctagcagttcaacttctgtaacgccagatgttagtgacaatgag
cctgatcattacagatactctgacaccactgactctgacccagagaatgaaccttttgat
gaagatcagcatacacagattacaaaagtctga

DBGET integrated database retrieval system