KEGG   Castor canadensis (American beaver): 109689825Help
Entry
109689825         CDS       T04791                                 

Gene name
Sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00020  Citrate cycle (TCA cycle)
ccan00190  Oxidative phosphorylation
ccan01100  Metabolic pathways
ccan01200  Carbon metabolism
ccan04714  Thermogenesis
ccan04932  Non-alcoholic fatty liver disease (NAFLD)
ccan05010  Alzheimer disease
ccan05012  Parkinson disease
ccan05016  Huntington disease
Module
ccan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ccan_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109689825 (Sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109689825 (Sdhb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    109689825 (Sdhb)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    109689825 (Sdhb)
   05012 Parkinson disease
    109689825 (Sdhb)
   05016 Huntington disease
    109689825 (Sdhb)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109689825 (Sdhb)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109689825 (Sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 109689825
NCBI-ProteinID: XP_020024456
UniProt: A0A250YED3
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGVSLRRWFPATTLGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKPGDKPHMQT
FEVNLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGDNTLACTRRIDTN
LNKVSKIYPLPHMYVMKDLVPDMSNFYAQYKSIEPYLKKRDESQEGKQQYLQSIEERDKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSL
YRCHTIMNCTLTCPKGLNPGKAIAEIKKMMAAYKEKRASM
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggcgtctccttgaggcgctggtttccagctacgacccttggcgga
gcgtgcctccaggcctgccgaggggcccagacagctgcagccacagctcctcgcatcaag
aaatttgccatttaccgatgggacccagacaagcctggagataaacctcatatgcagact
tttgaagttaatctgaataactgtggtcccatggtgttggatgctttaatcaaaattaag
aatgaaattgattcgaccttgaccttccgaagatcatgcagagaaggtatctgtggctct
tgtgcgatgaacatcaatggagacaacactctagcatgcacccggaggatcgacacaaac
ctcaacaaagtctctaagatctaccctcttccacacatgtatgtgatgaaggacctcgtt
cccgatatgagcaacttctatgcacagtacaagtccatcgagccctatctgaagaagagg
gacgaatcccaggaaggcaagcagcagtatctgcagtccatagaagaacgggataaactg
gacgggctgtatgagtgcatcctctgtgcctgctgcagcaccagctgccccagctactgg
tggaatggggacaagtacctgggccctgcagtccttatgcaggcctaccgctggatgatc
gactctagagatgagttcacagaggaacgcctggccaagctgcaggaccccttctctctg
taccgctgccacaccatcatgaactgcacactgacctgtcccaagggtctgaatccaggg
aaagctattgcagaaatcaagaaaatgatggcagcctataaggagaagagagcctcaatg
taa

DBGET integrated database retrieval system