KEGG   Castor canadensis (American beaver): 109691031Help
Entry
109691031         CDS       T04791                                 

Gene name
Tmprss9
Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109691031 (Tmprss9)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109691031 (Tmprss9)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109691031 (Tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 109691031
NCBI-ProteinID: XP_020026340
LinkDB All DBs
Position
Unknown
AA seq 1091 aa AA seqDB search
MEATAADLQLVPRATKEVAAPDSGCCRVAVIAVVVTSVVILSLGVLLAFLSAQDLCVEHS
AEVRGVGYSSALQRATSDYHRALTAALQVLFVSSFQKTELEASCVGCTVLSYRDGNSSVL
VRFRLHFLLRALWPLSLDLEENLLQQGIRARLGQHGVPLAAYGTIVSAELMGSLRGPVTG
RDFKSGHCSGNTFSCQNSQCVTKVNPECDDRADCSDGSDEAHCDCGLRPAWSTAGRIVGG
VEAAPGELPWQVSLRENGEHFCGATVIGARWLVSAAHCFNELQAPGAWVAAAGSTQLRGP
EAVRARVEQITRHPRYDADTADFDVAVLRLGRPLPLGRRIQPACLPAATHRFPPGKKCLI
SGWGHLREDFLIKPEVLQKATVELLDQALCASLYGHSLTDRMVCAGYLDGKVDSCQGDSG
GPLVCEEPSGRYFLAGVVSWGVGCAEVRRPGVYARITRLRDWILEVISVASLPVTPTAAS
VPTTPSTAWISSPKSPMANTPTKSTPAPSTVAFDAVTAAKPQECGARPAMEKPTRIVGGF
GAVSGEVPWQASLKEGSRHFCGATVVADRWLLSAAHCFNHTKAEQVQAHLGTVSLLGVGG
RPVKLGVRRVVLHPRYNPTILDFDVALLELARPLVFDKYIQPICLPLAIQKFPVGRKCVI
SGWGNMQEGNATKPDVLQKASVGIIDQMTCSALYNFSLTDRMLCAGFLEGRVDSCQGDSG
GPLACEESPGVFYLAGIVSWGIGCAQARKPGVYARITRLKGWILETMSLGPLPMPPTSAT
TTSHLPRATANLTVPGVTTSRPTTPEATSKATVCPPDTTASTRSTPARGQTPPVVAPETT
THSQPPDCGLAPASALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAH
CFDVYGDPKQWAAFLGTPFLSGAEGQLERVARIYKHPFYNLYTLDYDVALLELAGPVRRS
RLVRPICLPGPAPRPPDGARCVITXWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQI
STRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAA
VRGWIGQNIQE
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaccgcggcagacttgcagctcgtgccaagggcaaccaaggaagtcgctgcc
ccggactctgggtgctgtcgagtggctgtcattgcagtggtggtcaccagtgtggtcatc
ctctccctgggggtccttttggccttcctctcggcacaggacctgtgtgtggagcacagc
gcagaggtgcggggcgtgggttacagtagtgccctgcagagagccacctccgactatcac
cgtgcgctcacagccgcgctgcaagtgctgtttgtgagcagcttccagaagacggagtta
gaagccagctgtgtgggctgtacagtgcttagttacagggacggcaactccagtgtcctt
gtgcgtttccggctgcacttcctgcttcgagccctctggccactgagcctggacttggag
gagaacctcctgcagcagggcatccgggcaaggctgggccagcatggtgtccccctggct
gcctacggcaccatcgtgtctgctgagctcatgggaagcctcaggggaccagtgaccgga
agggacttcaaatcaggccactgttcagggaacaccttctcctgccagaacagccagtgt
gtgaccaaggtgaaccctgagtgtgacgacagagcagattgctccgatggatctgacgag
gcacactgtgactgcgggctgcggccagcctggagcacagcgggcaggatcgtgggtggc
gtggaggcggccccgggggagctcccctggcaggtcagcctgcgggagaacggggagcac
ttctgcggggccacggtcattggtgccaggtggctcgtgtcagccgcccactgcttcaac
gagctccaggccccgggcgcgtgggtggccgcggcgggcagcacgcagctccgcggcccc
gaggccgtgcgcgcgcgcgtggagcagatcaccaggcacccgcggtacgacgcggacacc
gcggacttcgacgtggccgtgctgcggctcggccgcccgctgcccctcggccgccgcatc
cagcccgcctgcctcccggccgccacgcaccgcttcccgcccggcaagaagtgcctcatc
tcgggctggggccacctcagggaggacttcttgatcaagccggaagtgctgcaaaaagcc
actgtagagctgctggaccaggccctgtgtgccagtctgtacggccactcgctcaccgac
aggatggtgtgtgctggttatttggatgggaaggtggactcctgccagggtgactcagga
ggccccctggtgtgcgaggagccttcgggcaggtactttctggctggcgtcgtgagctgg
ggcgttggctgtgcagaagtgcggcgtccgggggtctacgctcgcatcaccaggctgcgg
gactggatcctggaggtgatcagcgtggccagcctgcctgtgactcccacagcagcgtcc
gtccctaccacccctagcacggcctggatcagcagccccaagagcccaatggccaacacc
cccaccaaatccaccccggcccccagcactgtcgcctttgatgctgtcactgctgctaag
ccccaagagtgcggggccaggcccgcgatggagaagcccacccggattgtgggtgggttc
ggggctgtgtcaggggaggtaccctggcaggccagcctgaaggaaggttccaggcacttc
tgtggagccaccgtggtggctgaccgctggctgctgtctgctgcccattgcttcaaccac
acaaaggcagagcaggtgcaggcccacctgggcaccgtgtccctgctgggtgtcggtggg
cgccccgtgaagcttggggtgcggagggttgtgctgcatccccgttacaaccccaccatc
ctggacttcgatgtggccctgctggagctggccaggcctctggtcttcgacaagtacatc
cagcccatctgcctccccctggccatccagaagttccctgtgggcaggaagtgcgtgatc
tcaggctggggtaacatgcaggaagggaacgccaccaagccagatgtcctgcagaaggca
tccgtgggcatcatagaccagatgacctgcagcgcgctgtacaacttctccctcactgac
cgcatgctctgtgctggcttcctggaaggcagagtggactcctgccagggagactccggg
ggccccctggcctgtgaggagagccctggcgtcttctatttggcgggcatcgtgagctgg
ggcatcggctgtgcccaggcgaggaagcctggtgtgtacgcacgcatcaccaggctgaag
ggctggatcctggagaccatgtccttgggccccctccccatgcctcccacctcggccacc
actaccagccaccttcccagagcaacagccaacctcactgtccctggggtcaccaccagc
agacctaccacccctgaggccaccagcaaggcgaccgtctgccctccagacacaacagca
tccaccaggagcacccctgctcggggacagacgccacctgtggttgccccagaaaccacc
acgcactcccagccaccagactgcggcctggcgccggcctcggcgctgaccaggatcgtg
ggcggcagcgcggcggggcgcggcgagtggccgtggcaggtgagcctgtggctgcggcgc
cgcgagcatcgctgcggggcggtgctggtggccgagaggtggctgctgtcggcggcgcac
tgcttcgacgtctacggggacccgaagcagtgggcggcgttcttgggcacgccgttcctg
agcggcgcggagggccagctggagcgcgtggcgcgcatctacaagcacccgttctacaac
ctctacacgctcgactacgacgtggcgctgctcgagctggcgggcccggtgcgccgcagc
cgcctggtgcggcccatctgcctgccgggccccgcaccgcggccccccgacggcgcgcgc
tgcgtcatcaccngctggggctcggtgcgcgaaggagggtccatggcgcgccagctgcag
aaggcggccgtacgcctcctgagcgagcagacctgccgccgcttctacccggtgcagatc
agcacccgcatgctgtgcgccggcttcccgcagggcggcgtggacagctgctcgggtgac
gccggaggacccctggcttgcagggagccctctgggcggtgggtgctcactggggtcacc
agctggggctacggctgcggccggccccacttcccaggggtctacactcgagtggccgcc
gtgcgaggttggatagggcagaacatccaggaatga

DBGET integrated database retrieval system