KEGG   Castor canadensis (American beaver): 109691104Help
Entry
109691104         CDS       T04791                                 

Gene name
Setdb2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109691104 (Setdb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109691104 (Setdb2)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109691104 (Setdb2)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109691104 (Setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109691104 (Setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 109691104
NCBI-ProteinID: XP_020026463
UniProt: A0A250Y4D3
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFMFEKVQNVLQSLKQKIKNGSATNKEYIQAMVLVNEAT
ISNNSALVKDHMPVTQNEQENKSNAFPSTSYENYFPEDCIFLSTKNKDVLSLGNKVTDFR
RKESSLNLSYKHHDCSHACLMKMPPTFKGENPLQLPIKYHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNMEEVFRYLLETKCNFLFTDNFSFNTYVQLTRNYPKQEEVIFGVDISNGVES
VPISFCNEIDRRKLPQFKYRKTMWPRACYLSNFSTMFTDSCDCSEGCIDIAKCACLQLTS
RNAKTCPLSSGTITTGYKYKRLQRQIPTGIYECNLLCKCNRQFCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDKGTFICIYSGRLLSRNNPEKPSAIDESRKEENIMKNIFSKKRKI
EVSCSDCEIEVIPLEPETHPRSAKTEECPPKCNDDSKETVMEMNYNNISRTQYHSVIRSP
KSKTAIFQHNGKKMGFVSSESIISEDNDGCKAAQEHTNSKAKRAQEDSSSNHFEDSEDKQ
LVESDVIDVTKHREETAPGDRCKQATIWDNENIKKDFEIQIKKPQEEKSPACQNQQVFCD
EELTSETNNTSSDSLRKFNKGNIFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNF
PLVAFFTNRYVKARTELTWDYGYKAGTTPDKEIFCQCGVNKCRKKIL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctggaagatgatggaaaa
gtggactttatgtttgaaaaagtacaaaatgtactgcaatcactgaaacagaagatcaaa
aatgggtctgccacaaataaagagtatatccaagccatggttctagtgaatgaagcaact
ataagtaacaattcagcattggtaaaggatcatatgcctgtgactcagaatgaacaggaa
aacaaatcaaatgcatttccctctacatcatatgaaaactactttccagaagactgtatt
tttctatctacaaaaaataaggatgttctctctttgggaaataaagtcacagactttagg
agaaaggaatcatctttgaatttatcttataaacatcatgactgctctcatgcctgtctg
atgaaaatgccaccaaccttcaagggagaaaaccctctgcagctgccaatcaagtatcac
ttccaaagacgacatgcaaaaacaaactctcattcttctgcactccatgtgagttataag
actccttgtggaaggagtctacgaaacatggaggaagtctttcgttacctgcttgagaca
aaatgtaactttttatttacagacaacttttctttcaatacctatgttcagttgactcgg
aattacccaaagcaagaagaagttatttttggtgtggatattagtaatggagtggaatca
gtgcccatttctttttgcaatgaaattgacaggagaaagcttccacagtttaagtacaga
aagactatgtggccacgagcatgttacctaagtaacttttccaccatgtttactgattca
tgtgactgttctgagggctgcatagacatagcaaaatgtgcatgccttcaactgacctca
aggaatgccaaaacttgtcccttgtcaagtggtacaataactactggatataaatataaa
agactacagaggcaaatacctactggcatttatgaatgcaacctgctatgcaaatgtaat
agacaattttgtcaaaacagagttgtccaacatggtcctcaagtgaggctgcaggtgttc
aaaactgagaagaaaggatggggagtacgttgcctagatgacattgacaaagggacattt
atttgcatttattcaggaagattactaagcagaaataaccctgagaaacctagtgctatt
gatgaaagtagaaaagaagagaatattatgaaaaatatattttcaaaaaagaggaaaata
gaagtttcatgttcagattgtgagattgaagtcatcccattagaaccagaaacacatcct
agaagtgctaaaactgaggagtgtccacctaagtgtaatgatgactcaaaagagactgtt
atggaaatgaactataacaatatttcaagaactcaatatcattcagttattagaagtcct
aaatccaagacagccatttttcaacacaatgggaaaaagatgggatttgtttcctcagag
tctatcatctctgaagataatgatgggtgtaaagcagctcaagaacatacgaactctaaa
gccaagagagcacaagaggactcaagttcaaaccattttgaagattctgaagacaagcag
ctggttgaatcagatgtgatagatgtaactaaacatagagaagaaactgcaccaggggac
agatgtaagcaagcaaccatatgggataatgagaatattaaaaaggattttgagattcaa
ataaaaaagccccaagaggagaaatctccagcatgtcaaaaccagcaggtcttttgtgat
gaggagttaacaagtgaaaccaacaatacttcatctgattctctaaggaagttcaataaa
gggaatatatttttattggatgccacaaaagaaggaaatgtgggccgtttccttaatcat
agttgttgcccaaatctcttggtacagaatgtttttgtagaaacacatgacaggaatttc
ccattggtggcattcttcacaaacagatatgtgaaagcaagaacagaactaacatgggat
tatggttataaagctggaactacgcccgacaaggaaatcttctgccaatgtggagttaat
aagtgtagaaaaaaaatattataa

DBGET integrated database retrieval system