KEGG   Castor canadensis (American beaver): 109691463Help
Entry
109691463         CDS       T04791                                 

Gene name
Mgst2
Definition
(RefSeq) microsomal glutathione S-transferase 2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00480  Glutathione metabolism
ccan00980  Metabolism of xenobiotics by cytochrome P450
ccan00982  Drug metabolism - cytochrome P450
ccan00983  Drug metabolism - other enzymes
ccan01524  Platinum drug resistance
ccan05200  Pathways in cancer
ccan05204  Chemical carcinogenesis
ccan05225  Hepatocellular carcinoma
ccan05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    109691463 (Mgst2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109691463 (Mgst2)
   00982 Drug metabolism - cytochrome P450
    109691463 (Mgst2)
   00983 Drug metabolism - other enzymes
    109691463 (Mgst2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    109691463 (Mgst2)
   05204 Chemical carcinogenesis
    109691463 (Mgst2)
   05225 Hepatocellular carcinoma
    109691463 (Mgst2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    109691463 (Mgst2)
  Drug resistance
   01524 Platinum drug resistance
    109691463 (Mgst2)
Enzymes [BR:ccan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109691463 (Mgst2)
Transporters [BR:ccan02000]
 Other Transporters
  Pores ion channels [TC:1]
   109691463 (Mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 109691463
NCBI-ProteinID: XP_020027064
UniProt: A0A250Y9V6
LinkDB All DBs
Position
Unknown
AA seq 133 aa AA seqDB search
MVENAILLAAVSLLSACQQIYFALHVGKTRLQCKITAPAVTGSPQFERIFRAQQNSVEFY
PVFLITLWLAGWYFSQVFAAGLGLVYLFGRHKYFWGYSEAAEKRVFGFQLSLGTLALLIL
LSGLGIASHFLNE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaatgcaatcctgctggctgctgtctcccttctctctgcctgtcagcaaatc
tactttgctttgcacgttggaaagacaagattacaatgcaagatcactgccccagcagtc
actgggtcaccacagtttgagagaatatttcgtgcacaacaaaactctgtggagttttat
cctgtcttcctcataaccttgtggctggctggctggtatttcagccaagtttttgcagct
ggcctgggtctagtgtacctatttggccgtcacaagtacttctggggatattcagaagct
gctgaaaaaagggtcttcggtttccagttgagcctggggacattggccttgttgattctc
ctcagtgggctggggattgcaagccactttctcaatgaataa

DBGET integrated database retrieval system