KEGG   Castor canadensis (American beaver): 109691665Help
Entry
109691665         CDS       T04791                                 

Gene name
Map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04064  NF-kappa B signaling pathway
ccan04210  Apoptosis
ccan04380  Osteoclast differentiation
ccan04625  C-type lectin receptor signaling pathway
ccan04660  T cell receptor signaling pathway
ccan04668  TNF signaling pathway
ccan04672  Intestinal immune network for IgA production
ccan05166  Human T-cell leukemia virus 1 infection
ccan05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109691665 (Map3k14)
   04064 NF-kappa B signaling pathway
    109691665 (Map3k14)
   04668 TNF signaling pathway
    109691665 (Map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109691665 (Map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109691665 (Map3k14)
   04660 T cell receptor signaling pathway
    109691665 (Map3k14)
   04672 Intestinal immune network for IgA production
    109691665 (Map3k14)
  09158 Development
   04380 Osteoclast differentiation
    109691665 (Map3k14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    109691665 (Map3k14)
   05169 Epstein-Barr virus infection
    109691665 (Map3k14)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109691665 (Map3k14)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: STE group
  Other
   109691665 (Map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 109691665
NCBI-ProteinID: XP_020027409
LinkDB All DBs
Position
Unknown
AA seq 940 aa AA seqDB search
MAVMEVACPGTPGSIVGQQKELAKAKEKTQSLGKKQSCVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEGGPTAISIIAQAECENSQEFSPTFSERIFIAGSQQYSQSEGLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKRSKSPAQVDVALAKPLPRTPEQESCTVPVQED
ESPLGTLYVRNAPQFTKPLKEPGLGHLSFKKLDEGLRPVLPRPELHKLISPLQCLNHVWK
LHYPQDTGPLPHSAHPFPYKRLPHPFPFHPLQPWKPHPLESFFLDKLAGVDSQQHLPGTH
LSKLACVDNQKPLPGPHLEPGCSSRGTREKFSVEEYLVHALQGSVSSGQAHSLASLAKTW
SAGSSRAQRLSPETEDNEGVLLTEKLKPVDYEYREEVHWATHQPRLGRGSFGEVHRMKDK
HTGFQCAVKKVRVEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
IRQKGCLPEDRALYYLGQALEGLEYLHTRRVLHGDVKADNVLLSSDGSRAALCDFGHAMC
LQPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYF
RGPLCLKIASEPPPVREIPTSCTPLTAQAIQEGLRKEPVHRASAVELRGKVGWALQQVGG
LKSPWRGEYKEPRHLPPDQTNHHQTLHAQLTEHVPTQDTAGWAPKPQPPLPPEPPERNKS
PALNLSKEESGTWEPLPLSSLDPASAKGHSSQERRATLPELELQQLEIELFLNSLSQPFS
LEEQEQILSCLSIDSLSLSEDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSSSCNMVLA
RGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAPAFSLVTKDGQ
PVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaagtggcctgcccaggcactcctggctcaatagttgggcagcagaag
gaactcgccaaagccaaggagaagacacagtcactggggaagaagcagagctgtgtctat
aagcttgaggctgtggagaagagccctgtgttctgcgggaaatgggagatcctgaacgat
gtgattaccaaaggcacagccaaggagggctccgagggtggaccaaccgccatctccatc
atcgcccaggctgaatgtgagaatagccaagagttcagccccaccttttcagaacgcatt
ttcatcgcggggtcacagcagtacagccagtctgagggtcttgatcaaatccccaacaat
gtggcccatgcaactgagggcaaaatggcccgtgtgtgttggaagggaaaacgtcgcagc
aaagcccggaaaaaacggaagaagcgatcaaagtccccggcacaggtggatgtggccttg
gccaagccccttcccagaacccctgagcaagagagctgcacagtcccagtgcaggaggat
gagtctccactaggtactttgtatgtcagaaacgctccccagttcaccaagcctctgaaa
gaaccaggccttggccacctgtcctttaagaaactcgacgagggccttcgaccagtgctg
cctcgaccagaactccacaaactgatcagccccttgcagtgtctaaaccacgtgtggaaa
ctccactatccccaggacacaggcccactgccccattctgctcatcccttcccctacaaa
agactgccccatcccttcccattccaccctctccagccctggaaacctcaccctctggag
tccttcttcctggacaaactagctggtgtagacagccaacagcatctgcctggtacacac
ctaagcaaactggcctgtgtagacaatcaaaagcccctgcctggcccacacctggagcct
ggctgctcgtcccgtggcactcgtgagaaattttctgtggaggaatacctggtacatgct
ctgcaaggcagtgtgagctctggacaggcccacagcctggccagcctggccaagacctgg
tcagcagggagttccagggcccagaggctcagccctgaaactgaggacaatgagggggtc
ctacttactgagaaactcaagccagtggattatgagtaccgagaagaagtccactgggcc
acacaccagccccgcctgggcagaggctcctttggagaggtccacaggatgaaagacaaa
catacaggcttccaatgtgctgtcaaaaaggtgcgggtggaagtgtttcgggcagaggag
ctgatggcatgtgcaggattgacctcacccagaattgtccctctctatggcgctgtgagg
gaaggtccttgggtcaacatcttcatggagctactggaaggtggctcgctgggccagctc
ataaggcagaagggctgtctgccggaggaccgcgccctttactacctgggccaggccctg
gagggactggaatacctccacacgcgaagggttctgcacggagatgtcaaagctgacaac
gtgctcctgtccagcgatgggagccgagcagccctctgcgactttggccatgccatgtgc
ctgcaacctgatggcttggggaagtccttgctcacaggggactacatccctggcacagag
acacacatggccccagaggtggtgatggggaagccctgtgatgccaaggtggatatctgg
agcagctgttgcatgatgctacatatgctcaacggctgccacccctggactcaatacttc
cgaggcccgctctgcctcaagattgccagcgagcctccgcctgtgagggagatacccacc
tcctgcaccccactcaccgcccaggccatccaagaggggctgaggaaagagcctgtccac
cgagcatctgccgtagagctgcgagggaaggtcggctgggcactgcagcaagtgggaggt
ctgaagagtccttggaggggagaatataaagaaccaagacatctgccaccagaccaaacc
aaccatcaccagaccctacatgcccagctgactgagcatgtgccaacacaggacaccgca
ggctgggcccctaagcctcagcctcctctaccaccagagccaccagagcggaacaagtcc
ccagcactgaacttgagcaaggaggagtctggcacatgggaacccttgcctctgtcctcc
ctagacccagcctctgctaagggccacagctcacaagaacggagagctacccttcccgag
ctggaattgcagcagctggaaatagaattatttctgaacagcctgtcccagcctttttct
ctggaggaacaggagcaaatcctctcatgcctcagcatcgacagcctttccctgtcggag
gacagtgagaagaatccatcaaaggcctctcagagttcacgggacaccctgagttccggc
gtgcactcctggagcagccaggcggaggcgcgaagctccagctgcaacatggtgctagcc
cggggacggcccactgacaccccaagctacttcaatggtgtcaaagtccaaatacagtct
ctcaatggtgaacacctgcacatccgagagttccaccgggtcaaggtgggagacattgcc
acgggcatcagcagccagatcccagccccagccttcagcttggtgaccaaagatgggcag
cctgttcgctatgacatggaggtgccagactcgggcattgacctgcaatgcaccctggcc
ccagatggcagctttgcctggagctggagggtcaagcatggccagctggagaaccgaccc
tag

DBGET integrated database retrieval system