KEGG   Castor canadensis (American beaver): 109691916
Entry
109691916         CDS       T04791                                 

Gene name
Il2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04060  Cytokine-cytokine receptor interaction
ccan04061  Viral protein interaction with cytokine and cytokine receptor
ccan04151  PI3K-Akt signaling pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04630  JAK-STAT signaling pathway
ccan04658  Th1 and Th2 cell differentiation
ccan04659  Th17 cell differentiation
ccan04660  T cell receptor signaling pathway
ccan04672  Intestinal immune network for IgA production
ccan04940  Type I diabetes mellitus
ccan05135  Yersinia infection
ccan05142  Chagas disease
ccan05162  Measles
ccan05166  Human T-cell leukemia virus 1 infection
ccan05200  Pathways in cancer
ccan05320  Autoimmune thyroid disease
ccan05321  Inflammatory bowel disease
ccan05330  Allograft rejection
ccan05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109691916 (Il2)
   04151 PI3K-Akt signaling pathway
    109691916 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109691916 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109691916 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109691916 (Il2)
   04660 T cell receptor signaling pathway
    109691916 (Il2)
   04658 Th1 and Th2 cell differentiation
    109691916 (Il2)
   04659 Th17 cell differentiation
    109691916 (Il2)
   04672 Intestinal immune network for IgA production
    109691916 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109691916 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109691916 (Il2)
   05321 Inflammatory bowel disease
    109691916 (Il2)
   05330 Allograft rejection
    109691916 (Il2)
   05332 Graft-versus-host disease
    109691916 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109691916 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109691916 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109691916 (Il2)
   05162 Measles
    109691916 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109691916 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccan04052]
    109691916 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:ccan00536]
    109691916 (Il2)
Cytokines and growth factors [BR:ccan04052]
 Cytokines
  Interleukins
   109691916 (Il2)
Glycosaminoglycan binding proteins [BR:ccan00536]
 Heparan sulfate / Haparin
  Cytokines
   109691916 (Il2)
SSDB
Motif
Pfam: IL2 Aromatic_hydrox CK2S
Other DBs
NCBI-GeneID: 109691916
NCBI-ProteinID: XP_020027786
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLSCIALTFALVINSAPTSTSTKETQQQLEQLLLDLQMILKGVNNYKNPKLSRML
TFKFYTPKKATELKHLQCLEEELKPLEEVLNLAQSKSFQLKDKRDLISNINVTVLKLKES
EPPFMCEYDDETATIIEFLNKWITFCQTIISTLIR
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtcttgcattgcactaacttttgcacttgtcataaacagt
gcacccacttcaacctctacaaaggaaacacagcaacaactggagcaattactgctggac
ttacagatgattctgaaaggagttaataattacaagaatcccaaactctccaggatgctc
acttttaaattttacacacctaagaaggccacagaattaaaacatcttcagtgcctagaa
gaagaactcaagcctctggaggaagtgctaaatttagctcagagcaaaagctttcaattg
aaagataaaagggatttaatcagcaatatcaatgtaacagttctgaaactaaaggaatct
gaaccaccattcatgtgcgaatatgatgatgaaacagcaacgatcattgaatttctaaac
aaatggattaccttttgtcaaaccatcatctcaacactgattcgataa

DBGET integrated database retrieval system