KEGG   Castor canadensis (American beaver): 109691919
Entry
109691919         CDS       T04791                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01523  Antifolate resistance
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04062  Chemokine signaling pathway
ccan04064  NF-kappa B signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04210  Apoptosis
ccan04380  Osteoclast differentiation
ccan04620  Toll-like receptor signaling pathway
ccan04621  NOD-like receptor signaling pathway
ccan04622  RIG-I-like receptor signaling pathway
ccan04623  Cytosolic DNA-sensing pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04657  IL-17 signaling pathway
ccan04658  Th1 and Th2 cell differentiation
ccan04659  Th17 cell differentiation
ccan04660  T cell receptor signaling pathway
ccan04662  B cell receptor signaling pathway
ccan04668  TNF signaling pathway
ccan04920  Adipocytokine signaling pathway
ccan05132  Salmonella infection
ccan05135  Yersinia infection
ccan05142  Chagas disease
ccan05145  Toxoplasmosis
ccan05160  Hepatitis C
ccan05161  Hepatitis B
ccan05162  Measles
ccan05163  Human cytomegalovirus infection
ccan05164  Influenza A
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05168  Herpes simplex virus 1 infection
ccan05169  Epstein-Barr virus infection
ccan05170  Human immunodeficiency virus 1 infection
ccan05200  Pathways in cancer
ccan05203  Viral carcinogenesis
ccan05212  Pancreatic cancer
ccan05215  Prostate cancer
ccan05220  Chronic myeloid leukemia
ccan05221  Acute myeloid leukemia
ccan05222  Small cell lung cancer
ccan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccan05340  Primary immunodeficiency
ccan05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109691919 (Ikbkg)
   04014 Ras signaling pathway
    109691919 (Ikbkg)
   04064 NF-kappa B signaling pathway
    109691919 (Ikbkg)
   04668 TNF signaling pathway
    109691919 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    109691919 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109691919 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109691919 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    109691919 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    109691919 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    109691919 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    109691919 (Ikbkg)
   04660 T cell receptor signaling pathway
    109691919 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    109691919 (Ikbkg)
   04659 Th17 cell differentiation
    109691919 (Ikbkg)
   04657 IL-17 signaling pathway
    109691919 (Ikbkg)
   04662 B cell receptor signaling pathway
    109691919 (Ikbkg)
   04062 Chemokine signaling pathway
    109691919 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109691919 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109691919 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109691919 (Ikbkg)
   05203 Viral carcinogenesis
    109691919 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109691919 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109691919 (Ikbkg)
   05221 Acute myeloid leukemia
    109691919 (Ikbkg)
   05220 Chronic myeloid leukemia
    109691919 (Ikbkg)
   05215 Prostate cancer
    109691919 (Ikbkg)
   05222 Small cell lung cancer
    109691919 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    109691919 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109691919 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109691919 (Ikbkg)
   05135 Yersinia infection
    109691919 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109691919 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    109691919 (Ikbkg)
   05162 Measles
    109691919 (Ikbkg)
   05164 Influenza A
    109691919 (Ikbkg)
   05161 Hepatitis B
    109691919 (Ikbkg)
   05160 Hepatitis C
    109691919 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    109691919 (Ikbkg)
   05163 Human cytomegalovirus infection
    109691919 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109691919 (Ikbkg)
   05169 Epstein-Barr virus infection
    109691919 (Ikbkg)
   05165 Human papillomavirus infection
    109691919 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109691919 (Ikbkg)
   05142 Chagas disease
    109691919 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109691919 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109691919 (Ikbkg)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109691919 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 109691919
NCBI-ProteinID: XP_020027789
LinkDB
Position
Unknown
AA seq 413 aa
MSRHLWKNQLCEMVQPSSGPAGDQDVPGEEPSLGKPAMLHLPSEQGTPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLKRQREQ
ALQEVEYLKRCQQVQMAEDKASVKAQVTSLLGELQESQSRLETATKELQALEGRVRAASE
QARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ
EYDNHMKSSKGMQLEDFRQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD
IYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVETSQP
PLPPAPAHHSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgagcaggcacctctggaagaatcagctgtgtgagatggtgcagcccagcagtggtccg
gcaggggaccaggacgtgccgggtgaagagccttctctggggaaaccagccatgttgcat
ctgccttcagagcagggcactcctgagactctccagcggtgtctggaggagaatcaggag
ctccgagatgccatccgtcagagcaaccagatgctgcgggaacgttgtgaggagctgttg
catttccaagtcagccagagggaggagaaggaatttcttatgtgcaaatttcaggaagcc
aggaagctggtggagagactgagcctggagaagcttgacctaaagaggcagagggagcag
gccctacaggaggtggagtacctgaagagatgccagcaggtacagatggccgaggacaag
gcctccgtgaaagcccaggtgacatcgttgctgggggagctccaggagagccagagtcgc
ttggagactgccaccaaggaactccaggctttggagggcagggtgcgggcagccagcgag
caggccaggcagctggagagcgagcgggaggcactgcagcagcagcacagtgtgcaggtg
gatcagctgcgcatgcagagccagagcgtggaggctgccctgcgcatggaacgccaggcc
gcctcggaggagaagcggaagctggcccagttgcaggtggcttatcaccagctttttcaa
gagtatgacaaccacatgaagagcagcaagggaatgcagctggaggactttaggcagcag
ctccaacaggctgaggaggcccttgtggctaagcaggaagtgattgacaagttgaaggag
gaggctgagcagcacaagattgtgatggagaccgtgccagttctgaaggctcaggcggat
atctacaaggcagacttccaggctgagaggcaggcccgggagaagctggctgagaagaag
gagcttctgcaggaacagctggagcagctgcagcgggagtacagcaaactaaaggccagc
tgccaggagtcagccaggattgaagacatgaggaagcgtcatgtagagacctcccagccc
cctttaccccctgctccagctcaccactcctttcacctggccttgcccaaccagaggcga
agcccccctgaggagccacctgacttctgttgtcccaaatgccagtatcaggctcctgat
atggacactctacagatacacgtcatggaatgcattgagtag

DBGET integrated database retrieval system