KEGG   Castor canadensis (American beaver): 109692146Help
Entry
109692146         CDS       T04791                                 

Gene name
Hdac6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan05034  Alcoholism
ccan05165  Human papillomavirus infection
ccan05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    109692146 (Hdac6)
  09164 Substance dependence
   05034 Alcoholism
    109692146 (Hdac6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    109692146 (Hdac6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ccan01009]
    109692146 (Hdac6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ccan03019]
    109692146 (Hdac6)
   04131 Membrane trafficking [BR:ccan04131]
    109692146 (Hdac6)
   03036 Chromosome and associated proteins [BR:ccan03036]
    109692146 (Hdac6)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109692146 (Hdac6)
Protein phosphatases and associated proteins [BR:ccan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109692146 (Hdac6)
Messenger RNA biogenesis [BR:ccan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     109692146 (Hdac6)
Membrane trafficking [BR:ccan04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    109692146 (Hdac6)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109692146 (Hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 109692146
NCBI-ProteinID: XP_020028174
LinkDB All DBs
Position
Unknown
AA seq 1273 aa AA seqDB search
MEKRASGARGPTGRREFGGANQGRSLRKGLRSSRGRAAASPAMTSTGQDSTTTRHRKSRH
NPQSPSHDLSITSKRSVKKGAAPRSTPNLAEIKKKGKMKKLSQKVEEDLIVGLQGLDLNP
EVKIVTGTGLVFDEQLNEFYCLWDDSFPESPERLHAIKEQLIQESLLDRCVCFQARFAEK
EELMLVHSLEYIDLMEMTQYMNEGELRVLASTYDSVYLHPNSYSCACLASGSVLRLVDAV
LGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQKKHRIQRVLIVDWDVHHGQ
GTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSATGFGQGQGYTINVPWNQVGMRDAD
YIAAFLHILLPVAFEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKL
ILSLEGGYNLHSLAKGVSASLHTLLGDPCPMLESPGVPCRSAQTSLSCTLEALEPFWGIL
VRSVDTPEEDGEEEDTVEETEEGPWEASALPVLTWPVLQHRTGLVYDQRMMSHCNLWDNH
HPETPQRILRIMCHLEELGLAAHCLILPVRAATDAELLTCHSAEYVERIRATEKMKTREL
HREGANFDSIYLCPSTFTCAQLAAGAACRLVEAVLSGEVLNGIAVVRPPGHHAEHAAACG
FCFFNSVAVAARHAQTISGRALRILIVDWDVHHGNGTQHIFEDDPSVLYVSLHRYDRGTF
FPMGDEGASSQIGRAEGTGFTVNVPWNGPRVGDADYLAAWHRLVLPIAYEFNPELVLVSA
GFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGHIILILEGGYNLTSISESMAACTHSLL
GDPPPLLPLLRPPQPGALASITETIQVHRRYWRSLRVMKVEDKETSSASKPVTKKASHPT
NPKLAKGVTMPEGKILRAGMKKATSTLPAKESTPGQTKSKTANVATLTQDQCLERATGGA
KLDQTTSEETVERATVDQTTSEESVGGATVGQATTEESVGEATVDQATTEESVEEAAVEQ
ATTEETVEGATGDEATSVESVRGARVDQVNSEAATGEVMLDQTTSEETAGESEVIQTPLA
SNTDKQTPAASPVRGATAQSSPCQLIGSHRILELGNETQETLESQTLGEEGLLGEAAGGQ
DTDCSVLMQDFGELGDSDEDIFYAVTPLSWCPHLGAVCPIPEEGLDTAQPCERCGTFEEN
WLCLSCYKIYCSRYVSAHMVCHFEASRHPLVLSCVDLSAWCYICQAYVHHQDILHVKNVV
HQIKFGEDIPQPH
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagggcatccggtgcccgaggccccacaggtcgccgggaatttggcggtgcg
aaccaagggcggagtttgagaaaagggctgcgctcaagccgcggcagagctgcagcctcc
ccagccatgacctccaccggccaggattccaccactaccagacatcgtaagagtagacac
aacccccagtcgccctctcacgacttgagcattacctcgaaacgaagtgttaagaagggt
gctgcaccccgctccactcccaatctagcagaaataaagaagaaaggcaagatgaagaag
ctgagccaaaaagtcgaagaagacctaatcgtggggctgcaagggctggatctgaaccct
gaggtcaagatagtgacgggcactggccttgtgtttgatgagcagctaaatgaattctac
tgtctctgggatgacagcttccctgaaagccctgagcgactccatgccatcaaggagcag
ctgatccaggagagtcttctcgatcgctgtgtgtgctttcaggcccggttcgcagaaaag
gaggagctgatgttggttcacagcctagagtacattgatctgatggagatgacccagtac
atgaatgagggagaactccgcgtactggcaagcacctatgattcagtttatctgcatccg
aactcatactcctgtgcctgcctggcctcaggctctgttctcaggctggtagatgccgtc
ctgggagctgagattcgaaatggcatggctatcatcaggcctcctggacaccatgcccag
cacagtcttatggatgggtattgcatgttcaaccatgtggctgtggctgcccgctatgct
caaaagaaacaccgcattcagagagtccttattgtggattgggatgtacaccacggtcaa
ggaacacagttcaccttcgaccaggaccccagtgtcctctatttctctatccaccgctat
gagcagggtcgattctggccccaccttaaggcctctaactggtctgccacaggttttggt
caaggccaaggatacaccatcaatgtgccttggaaccaggtggggatgcgggatgccgac
tacattgctgctttcctgcatatcttgctgccagttgcctttgagttccagcctcagctg
gtcctagtagctgctggatttgatgccctccaaggggaccccaagggtgagatggctgcc
actccagcagggtttgcccagctaacccacctactcatgggtttggcaggaggcaagctg
attctgtctctagagggtggctacaaccttcactcccttgctaaaggtgtcagtgcatca
ctccacacccttttgggagacccttgccccatgctggagtcccctggtgtgccctgtcga
agtgcccagacttcactctcctgtactctggaagccctagaacccttctggggaatcctt
gtgagatcagtagacactccagaggaggacggcgaggaggaagacactgtggaggagacc
gaggaaggaccctgggaagcctctgcgctaccagtcttgacatggccagtgctgcagcat
cgcactggtctggtctatgaccaaagaatgatgagtcactgcaacctatgggacaaccat
caccccgagacacctcagcgtatcttgcggatcatgtgccacctggaggagctgggcctt
gccgctcactgcctcatcctgcctgtgcgggctgccacagatgccgagctgctcacctgc
cacagtgctgagtatgtggagcgtatccgggccacagagaagatgaagacccgggagttg
caccgcgaaggtgccaactttgactccatctacctctgtcccagcaccttcacctgtgcg
cagctggctgcaggcgctgcctgccgcctggtggaagctgtgctctcaggagaggttttg
aacggtattgcagtggtgcgccccccaggacaccatgctgagcatgctgctgcttgcggt
ttctgctttttcaactctgtggctgtggctgctcgccatgctcagaccatcagtgggcgt
gccctgaggatcctgattgtggattgggacgtccatcacggcaatggaactcagcacata
tttgaggatgaccccagtgtgctatatgtatccctgcaccgatatgaccgtggcaccttc
ttccccatgggggatgagggtgccagcagccagataggccgggcagagggcaccggcttc
actgtcaatgtaccctggaatggaccccgcgtgggtgatgctgactacctggctgcctgg
catcgtcttgtgcttcctattgcctatgagtttaacccagaactggtactggtctcagct
ggctttgacgctgcacgaggggacccgctaggaggttgccaggtgtcacctgagggttat
gcccacctcacccacctgctgatgggccttgccaatggtcacattatccttatcctagag
ggtggctacaacctgacatctatctcagagtccatggctgcctgcacccactccctcctt
ggagacccgccaccactactgcccttgctgcggcctccgcaaccaggggccttggcttca
atcactgagaccatccaagttcatcgcagatactggcgcagtttgcgggtcatgaaggta
gaagacaaggagacatcttccgcttctaagcccgtcaccaagaaggcatcccatccaacc
aatcctaaattggctaaaggggtgaccatgccagaagggaagattctgagagcaggcatg
aagaaggctacctcaacattacctgcaaaagagtctactccaggacagactaaatcaaag
acagctaatgtagccacactcactcaggaccagtgcttagagagagccactgggggagct
aaactagaccagaccacctcagaggagactgtggaaagagccacagtggaccaaaccacc
tcagaagagtctgtgggaggagccacagtgggtcaggccaccacagaggagtctgtggga
gaagccacagtggaccaggccaccacagaggagtctgtggaagaagctgcagtggagcag
gccaccacagaggagactgtggaaggagctacaggggacgaggccacttcagtggagtct
gtgagaggagccagagtggaccaggtcaactcagaagcagccacaggggaagtcatgctg
gaccagaccacttcagaggagactgcaggagaaagtgaggtgattcaaactcctctagcc
tcaaacacagacaagcagactccagcagcctcacctgtgcggggagccacagcccagtca
tccccctgtcagctgattgggagtcacaggattttggaactaggcaatgaaactcaggag
accctagagtctcagaccctaggagaagagggcttactaggagaggcagctggaggtcag
gacactgactgctcagtgctgatgcaagactttggggaacttggtgacagtgatgaggac
atattttatgctgtgacaccactgtcctggtgtccccatttgggggcagtatgccccata
cctgaagaaggcctggacacagctcagccttgtgaacgctgcggaacatttgaggagaac
tggttgtgtttatcttgctataagatctactgtagtcgctacgtcagtgctcatatggtg
tgccactttgaagcctctagacacccactggtcctcagctgtgtggacctgtctgcctgg
tgttacatctgtcaggcctatgtccaccaccaggacatcctgcatgtgaagaatgttgtc
caccagatcaagtttggggaggacattcctcaaccacactaa

DBGET integrated database retrieval system