KEGG   Castor canadensis (American beaver): 109692710Help
Entry
109692710         CDS       T04791                                 

Gene name
Sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00040  Pentose and glucuronate interconversions
ccan00051  Fructose and mannose metabolism
ccan01100  Metabolic pathways
Module
ccan_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109692710 (Sord)
   00051 Fructose and mannose metabolism
    109692710 (Sord)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109692710 (Sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 109692710
NCBI-ProteinID: XP_020029095
UniProt: A0A250YGJ3
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MAAADKAENLSLVVHGPGDIRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDF
VVKKPMVLGHEAAGTVVKLGSSVKHLKPGDRVAIEPGYPRETDEFCKIGRYNLTPSIFFC
ATPPDDGNLCRFYKHNADFCYKLPDGVTFEEGALIEPLSVGIYACRRGGISLGNKVLVCG
AGPIGLVSLLVAKAMGAAQVVVTDLSAPRLSKAKEVGADFILQIAKESPKEVASKVEELL
GCKPDVTIECTGVESSVQTGIYATASGGTLVIVGMGSEMISIPLVHAAAREVDIKGVFRY
CNTWPMAISMLASKTMNVKPLVTHRFPLEKAVEAFETSKKGVGLKVMIKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcagataaggccgagaacctctcgctggtggtgcacggacccggggacatt
cgcttggagaactatccaatccctgagccaggcccaaatgaggtgctgctgaagatgcat
tctgttggaatctgtggctcagacgtccactactggcagcatggccgaattggagatttt
gttgtgaaaaaaccaatggtgctggggcatgaagctgcaggaacagttgtaaaattgggg
tcatcggtaaagcacctaaaaccaggtgatcgtgttgccattgagcctggttatccccga
gaaacagatgaattctgcaagattggccgatacaatctgacaccatctattttcttctgt
gccacacccccggatgatgggaatctttgccggttctataagcacaatgctgacttctgc
tacaagcttcctgatggtgtcacctttgaggaaggggccttgattgagccactctctgtt
ggaatctatgcctgccggcgaggaggaatctctttagggaacaaggtccttgtttgtgga
gctgggccaattgggctggtcagtttgcttgtggccaaggcaatgggagcagctcaagta
gtggtgactgatctatctgcacctcggttgtccaaagccaaggaagtcggagctgatttc
attctccagatcgctaaggagagccctaaggaagttgccagtaaagtggaggagctgttg
gggtgcaagccagatgtcaccatcgagtgcacaggggtggagtcctcggtccaaacaggc
atctatgctactgcttctggtggaacactggtgatcgtggggatgggctctgagatgatc
agtatacccctagtgcatgcagccgcccgggaggtggatatcaagggcgtgtttcgatac
tgcaacacgtggccgatggcgatttcaatgcttgcatccaagactatgaatgtaaaaccc
ttagtcacccacaggtttcctctggagaaagctgtggaggcctttgaaacatccaaaaag
ggagtggggttgaaagtcatgatcaagtgtgaccccaatgaccagaatccctga

DBGET integrated database retrieval system