KEGG   Castor canadensis (American beaver): 109692901Help
Entry
109692901         CDS       T04791                                 

Gene name
Tgm3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109692901 (Tgm3)
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109692901 (Tgm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 109692901
NCBI-ProteinID: XP_020029446
LinkDB All DBs
Position
Unknown
AA seq 694 aa AA seqDB search
MSALEFQNVNWQVAANRHAHHTDKFSSKELIVRRGQSFNILIVCNRRLQSGERLDIIVST
GPYPSESARTKATFPVSSETSRGGWNAVLSANNDNVLTIAIVSPVNAPIGWYTMDIQISS
NGSVSSAKLGKFILLFNPWLQTDDVFMSNQAERQEYVEEDSGIIYVGSTNRISMVGWNFG
QFEEDILNISLSILDKSLNFRRDPATDVANRNDPKYVGRVLSAMINSNDDNGVLAGNWSG
SYTGGRDPRNWNGSVEILKEWKKSGFRPVRYGQCWVFAGALNTVLRSLGIPSRVITNFNS
AHDTDRNLSVDVYYDAMGNPLDKGSDSIWNFHVWNEGWFVRTDLGPSYNGWQVLDATPQE
RSQGVFQCGPASVNAVREGDVDKNYDMIFIFSEVNADRITWLYDTRNGTQKQNSLDTSSI
GKYISTKAVGSNSRMDVTDKYKYPEGSSEERRVHQKALSKLKPNMSFGATSARNLSGEEE
EPSISGRFKVTGVLTVGKEVNLALILKNLTTDRKTVTVNMTAWTIVYNGTLVHEVWKGSA
TIALDPEEEVQHPVKITYAQYDKYLKADNMIRTTAVCKVTDEAEVVVERDVILDNPTLTL
EILDQAQVRKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLRGNLKIEVPSLRPKEKSRVRF
EILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttagagttccagaatgtcaactggcaggtggctgccaaccggcatgcacat
cacacagacaagttctccagcaaggagctcatcgtgcggagaggccaatccttcaatatc
ttaatagtctgtaaccgaagacttcaatctggagaacgtctggacatcatagtctctaca
gggccttacccctcagagtcagccaggacaaaggctacgtttccagtctctagtgagaca
agtagaggtggctggaatgcagtgctcagtgccaataatgacaatgtgttgaccatcgcc
atcgtcagtcctgtcaatgcacccataggatggtacaccatggacattcagatctcctcc
aatggcagtgtctcctctgcgaaacttgggaagttcatactgctctttaacccctggttg
caaacggatgatgtctttatgagtaaccaggctgagagacaagagtatgttgaggaagat
tctggaatcatctacgtgggcagcacaaatcgaattagcatggttggctggaactttgga
cagtttgaagaagacattctgaacatcagcctctccatcttggataagagtctcaatttc
cgccgtgaccctgctactgatgtggccaacagaaacgaccccaaatatgttggccgggtg
ctgagtgccatgatcaatagcaatgatgacaacggtgtgcttgctgggaattggagcggc
agttacacaggtggccgcgacccaaggaactggaatggcagtgtggaaatcctcaaggag
tggaaaaaaagtggcttcaggccagtccgatatgggcagtgctgggtctttgctggggcc
ctcaacacagtgctgcggtccttgggaattccctctcgggtgatcactaacttcaactca
gctcatgacacagatagaaacctcagtgtggatgtgtactatgacgccatgggaaaccct
ctggacaaaggcagtgatagcatatggaatttccacgtctggaatgaaggctggtttgtg
cgcactgacctgggcccctcgtacaatggatggcaggttctggatgctaccccacaggag
aggagccaaggggtgttccagtgcggccctgcttccgttaacgcagtccgagagggggat
gtggacaagaattacgatatgatcttcatcttctcggaggtcaatgccgaccgcatcacc
tggctctatgataccaggaatggtacccagaagcaaaattccttggacactagctccatt
ggcaaatacatcagcaccaaggcagtaggcagcaactctcgcatggatgtcacagacaag
tacaagtatccagaaggttccagtgaggaaagacgagtgcaccagaaggctttgagcaaa
cttaaacctaatatgtcatttggcgcaacatctgcgaggaatttatcgggagaggaagag
gagcccagcatctcggggaggttcaaggttactggtgtactgacggtgggcaaagaagtc
aacctggccctgatactcaaaaacctgaccactgaccggaagacagtgacagtgaacatg
acagcatggaccatcgtctacaatggcacacttgttcacgaggtgtggaagggctctgcc
acaatagccctggaccctgaagaagaagtacaacatcctgtgaagatcacatatgcccag
tatgataagtacctgaaggcagacaacatgattcggaccacagcggtatgcaaggtgact
gatgaggctgaggtggtagtggagcgggatgtcatcctggacaaccccaccctgaccctg
gagattctggaccaggctcaagtgcggaagcctgtgaatgtgcagatgcttttctccaac
cccttggacgaaccagtgaaggactgtgtgctgatggtggagggcagtggcctgctgcgg
ggtaacctcaagattgaggtaccgtccctgcgccccaaggagaagtcccgggtccgcttc
gagatcctgcccactcgcagtggcaccaagcagctgctcgctgacttctcctgcaacaag
tttcctgcaatcaaggccatgctgtccatcgatgtggctgagtga

DBGET integrated database retrieval system