KEGG   Castor canadensis (American beaver): 109692991Help
Entry
109692991         CDS       T04791                                 

Gene name
Hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04110  Cell cycle
ccan04213  Longevity regulating pathway - multiple species
ccan04330  Notch signaling pathway
ccan04919  Thyroid hormone signaling pathway
ccan05016  Huntington's disease
ccan05034  Alcoholism
ccan05165  Human papillomavirus infection
ccan05169  Epstein-Barr virus infection
ccan05200  Pathways in cancer
ccan05202  Transcriptional misregulation in cancer
ccan05203  Viral carcinogenesis
ccan05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    109692991 (Hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    109692991 (Hdac1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    109692991 (Hdac1)
  Aging
   04213 Longevity regulating pathway - multiple species
    109692991 (Hdac1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    109692991 (Hdac1)
   05202 Transcriptional misregulation in cancers
    109692991 (Hdac1)
   05203 Viral carcinogenesis
    109692991 (Hdac1)
   05220 Chronic myeloid leukemia
    109692991 (Hdac1)
  Neurodegenerative diseases
   05016 Huntington's disease
    109692991 (Hdac1)
  Substance dependence
   05034 Alcoholism
    109692991 (Hdac1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    109692991 (Hdac1)
   05165 Human papillomavirus infection
    109692991 (Hdac1)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109692991 (Hdac1)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     109692991 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     109692991 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109692991 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    109692991 (Hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 109692991
NCBI-ProteinID: XP_020029576
UniProt: A0A250Y1P3
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MAHTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatactcagggcaccaggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctactcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaatttttgcgctccattcgt
ccagataacatgtctgagtacagcaagcaaatgcagagattcaatgttggtgaggactgt
ccagtatttgatggcctgtttgagttctgtcagttgtctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgcagtgaattgggctgggggcctgcac
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatatacaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaaa
tattatgctgttaactacccactccgagatgggattgatgacgagtcctatgaggccatt
tttaagccggtcatgtccaaagtaatggagatgttccagcctagcgcggtggtcttacag
tgtggctcagactccctgtctggagatcggttaggttgcttcaatctgaccatcaaaggg
catgccaaatgtgtggaatttgtcaagagcttcaacctgcctatgctgatgctgggagga
ggtggttacaccattcgaaatgttgcccggtgctggacatatgaaacagctgtggccctg
gacacagagatccctaatgagcttccatacaatgactactttgaatactttggaccagac
ttcaagcttcacatcagtccttccaatatgactaaccagaataccaatgagtacctggag
aagatcaaacagcgactcttcgagaacctgagaatgctgccccatgcacctggtgtccaa
atgcaagcaattcctgaggatgccattccagaggagagtggcgatgaggatgaagaagac
cctgacaagcgcatctccatttgctcctctgacaagcgaattgcctgtgaggaagaattc
tctgactcagatgaggagggagagggtggccgcaagaattcttccaatttcaagaaagcc
aagagagtcaaaacagaagatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagaagtcaag
ctggcctga

DBGET integrated database retrieval system