KEGG   Castor canadensis (American beaver): 109693015
Entry
109693015         CDS       T04791                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00220  Arginine biosynthesis
ccan00330  Arginine and proline metabolism
ccan01100  Metabolic pathways
ccan04020  Calcium signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04146  Peroxisome
ccan04371  Apelin signaling pathway
ccan04926  Relaxin signaling pathway
ccan05010  Alzheimer disease
ccan05014  Amyotrophic lateral sclerosis
ccan05022  Pathways of neurodegeneration - multiple diseases
ccan05133  Pertussis
ccan05140  Leishmaniasis
ccan05142  Chagas disease
ccan05145  Toxoplasmosis
ccan05146  Amoebiasis
ccan05152  Tuberculosis
ccan05200  Pathways in cancer
ccan05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109693015 (Nos2)
   00330 Arginine and proline metabolism
    109693015 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109693015 (Nos2)
   04066 HIF-1 signaling pathway
    109693015 (Nos2)
   04020 Calcium signaling pathway
    109693015 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109693015 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109693015 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109693015 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109693015 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109693015 (Nos2)
   05014 Amyotrophic lateral sclerosis
    109693015 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109693015 (Nos2)
   05152 Tuberculosis
    109693015 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109693015 (Nos2)
   05145 Toxoplasmosis
    109693015 (Nos2)
   05140 Leishmaniasis
    109693015 (Nos2)
   05142 Chagas disease
    109693015 (Nos2)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109693015 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 109693015
NCBI-ProteinID: XP_020029612
LinkDB
Position
Unknown
AA seq 1171 aa
MACPWKFLFKARSHQYNLTEEKDINNNVGKAMGAISSPSTQDDPKCHSPSKHQNGFPQPL
IGVAKSPEPLDKLHMPASTCQQYMRIKNWGSGVSFQDTLHQKAKSDLACKSKSCQGSIMN
PKSLTRGPRDKPTSVDELLPQAIEFINQYYSSFKEAKIEEHLARVEAVTKEIETTGTYRL
TGDELIFATKLAWRNAPRCIGRIQWSNLQVFDARSCTTAQEMFEHICRHLHYATNSGSIR
SAITVFPQRSDGKHDFRVWNTQLIRYAGYQMPDGTIRGDPANLEFTQLCIDLGWKPRYGR
FDVLPLVLQANGRDPELFEIPPDLVLEVPMEHPKYEWFQELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVA
VLHSFQKHNVTIMDHHSAAESFMKHMQNEYRLRGGCPADWIWLVPPISGSITPVFHQEML
NYVLSPFYYYQVEPWKTHVWQDKKQRPGRRELRFQVLVKAVLFSSILIRKIMASRVRVTI
LYATETGRSEALAQDLGTLFSCAFNPKVLCMDEYRLSNLEEEQLLLVVTSTFGNGDSPGN
GETLKKSLFTLKELTNTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLTPTGEGDE
LSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSSATWEAQNYRLVQNSQSFELH
KALGSVHSKHVFTLRLKSQQNLQSPKSSRTTLLVELSCKDSPGLSYLPGEHLGVFPSNQP
ALVQGILERVVDSPKPHQTVCLEALDKSGSYWVRDKRLPPCSLSQALTYFLDITTPPTQL
QLQKLAQLATEEAERQRLETLGQPSEYNKWKFTNSPTFLEVLEEFPSLRVPAAFLLSQLP
ILKPRYYSISSSQDHTPTEVHLTVAVVTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFV
RSAKGFQLPKDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGHMTLVFGCRCPDE
DHLYWEEMLEMARKGVLHELHTAYSRLPGKPKVYVQDLLRQQLAGEVLRVLHEEPGHLYV
CGDVRMARDVVHTLKQLVADSLNLNEEQVEDYFFQLKSQRRYHEDIFGAVYSYQVRKDRT
AGQTSDGEVEAAGMKYNNGDTVELWSTALRR
NT seq 3516 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaagtttctgttcaaggccagatcccaccagtataacttgactgag
gaaaaggacatcaacaacaatgtggggaaagctatgggtgccatctccagtccttcgaca
caggatgaccccaagtgtcacagccccagcaaacaccagaatggattcccacaacccctc
ataggggtggcaaagtctccagaacccctggacaaactgcatatgcctgcatcaacttgc
cagcagtatatgaggatcaaaaactggggcagtggggtgtcattccaagacacacttcac
caaaaggccaaatcggatttagcctgcaagtcaaaatcttgccaggggtccatcatgaac
cccaaaagtttgaccagaggacccagggacaagcctacctctgtggatgagcttctacct
caggctattgaatttatcaaccagtattacagctccttcaaagaggcaaaaatagaggaa
catctggccagggttgaggcggtcacaaaggagatagaaacaacaggaacctaccggctg
acgggggatgagctcatctttgccaccaagctcgcctggcgcaacgccccccgctgcatt
ggcaggatccagtggtccaacctgcaggtcttcgacgcccggagctgtaccacagcccag
gagatgtttgaacacatctgcagacacctgcactacgccaccaacagcggcagcatcagg
tcggctatcacagtgttcccccagcggagtgatgggaagcatgacttccgggtgtggaat
acacagctcatccgctacgctggctaccagatgcctgatggcaccatcagaggggaccct
gccaacctggagttcacccagctgtgcatcgatctgggctggaagccccgctatggccgc
tttgatgtgctgcctctggtcctgcaggctaacggccgtgaccctgaacttttcgaaatt
cctcctgaccttgtgctcgaagtgcccatggaacatcccaagtatgagtggttccaggag
ctggagctgaagtggtatgccctgcctgctgtggctaacatgctgctcgaagtgggtggc
ctcgagttcccggggtgccccttcaatggctggtacatgggcaccgagattggagtccgg
gacttctgtgacacccagcgctataacatcctagaggaagtgggcagaaggatgggtctg
gagacacacacgctggcctccctctggaaagaccgagctgtcacagagatcaatgtcgct
gtgctgcacagtttccagaagcacaatgtgaccatcatggaccaccactcggctgcagag
tccttcatgaagcacatgcagaatgagtaccggttacgtggcggctgcccggccgactgg
atttggctggtccctccaatttctgggagcatcacccccgtgtttcaccaggagatgttg
aattacgtgctgtccccattctactactatcaggtggagccctggaagacccatgtctgg
caggacaagaagcagagacctgggagaagagagctccgattccaagtcttggtgaaagct
gtgcttttctcctctatactgatacgtaagattatggcgtcccgagtcagagtcacaatc
ctctacgcaactgagacaggaaggtcagaagcactggcccaggacctggggaccttgttc
agctgtgccttcaaccccaaggttctctgcatggatgagtacaggctgagcaacctggag
gaggagcagctactgctggtggtgaccagcacgtttgggaatggagactcccctggcaat
ggcgagacactgaagaaatccctcttcacgctgaaagagctcaccaacaccttcagatac
gctgtgtttggccttggctccagcatgtacccacaattctgtgcctttgctcatgacatc
gaccagaagttgtcccagctgggggcctctcagctcaccccaacaggggaaggggacgag
ctcagtgggcaggaggacgccttccgcagttgggccgtgcaaaccttcaaggcagcctgt
gagacgtttgatgtccgaggcaaacagcacattcagatccctaagctctacacctctagc
gcgacctgggaggcgcagaactacaggctcgtacagaactcacagtcgtttgaactccac
aaagcccttggcagtgtgcactccaagcatgtgttcaccctgaggctcaaatcccagcag
aatctgcagagtcccaagtccagccgtactaccctcctggtagaactctcctgcaaggac
agcccaggcctgagctacctgcctggagagcacctcggggtttttccaagcaaccagcca
gccttggtccaaggcatcttggagcgagtagtagatagccccaagccccaccaaaccgtg
tgcctggaggccctggacaagagtggcagctactgggtcagagacaagaggctgcctccc
tgctcactcagccaggccctcacctacttcctggacatcaccacccctccaacccagctg
cagctccaaaagctggcccagctagccacagaagaggctgagagacagaggctggagacc
ctgggtcagccctcagagtacaacaagtggaagttcaccaacagccccacgttcctggag
gtgctggaggagttcccatcactgcgggtccctgctgcctttctgctgtcccagctcccc
attctgaagccccgctactactccatcagttcctcccaggaccacacacccacagaggtc
caccttacagtggccgtggtcacctaccgcacccgagatggtcagggtcccttgcaccac
ggcgtctgcagcacttggctcagcagcctgaagccccaggacccagtgccctgttttgtg
cgaagtgccaaaggcttccagcttcccaaagacccctcccaaccttgcatcctcatcggg
cctggcacaggcatcgcgcccttccgcagtttctggcagcagcgactccatgactcccaa
cacaaagggctcaaggggggccacatgaccctggtgttcgggtgccgctgtccagacgag
gaccacctgtactgggaggagatgttggagatggccaggaagggcgtgttacatgagctg
cacacagcctattctcggctgcctggcaagcccaaggtctacgttcaagacctcctgcgg
cagcagctggcaggtgaggtgctccgcgtgctccatgaggagccaggccacctctatgtt
tgtggggatgtgcgcatggcccgggacgtggtccacaccctgaagcagttggtggctgac
agcctgaacttgaatgaggagcaggttgaggactatttcttccagctcaagagccagagg
cgctatcatgaagatatctttggtgctgtctattcctaccaagtgagaaaggacaggaca
gcggggcagaccagcgatggagaagttgaagctgctggaatgaaatataacaatggagac
actgttgagctgtggtccacggccctaaggagatag

DBGET integrated database retrieval system