KEGG   Castor canadensis (American beaver): 109693231
Entry
109693231         CDS       T04791                                 

Gene name
Rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04014  Ras signaling pathway
ccan04390  Hippo signaling pathway
ccan04392  Hippo signaling pathway - multiple species
ccan05200  Pathways in cancer
ccan05206  MicroRNAs in cancer
ccan05219  Bladder cancer
ccan05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109693231 (Rassf1)
   04390 Hippo signaling pathway
    109693231 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    109693231 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109693231 (Rassf1)
   05206 MicroRNAs in cancer
    109693231 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    109693231 (Rassf1)
   05223 Non-small cell lung cancer
    109693231 (Rassf1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 109693231
NCBI-ProteinID: XP_020030002
LinkDB
Position
Unknown
AA seq 373 aa
MLGAAPKSRPALWPRPPCTPNAQSQLKLWVERAMSAEPELIELRELAPVGRTGPGRTRLE
RANALRIAPCTSRNPARQQVPGRGHRFQPAGPATHTWCDLCGDFIWGVVRKGLQCAHCKF
TCHYRCRALVCLDCCGPRDLGWDPALERDTNVDEPVEWETPDLSQAEIEQKIKEYNGQIN
SNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGSGRSTAVRRRTSFYLP
KDTIKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYFRKLSDDEQPLR
LRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSRCR
QKIQEALHACPLG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgctgggggcggcgccgaagtctcggcccgccctgtggccccgcccgccctgcactccc
aacgcccagagtcagctgaagctctgggttgagcgggccatgtctgcggagccagagctc
attgagctgcgggagctggcacctgttgggcgcaccggcccgggccgcacccgactagaa
cgtgccaacgcgctgcgcatcgcgccctgcacttctcgcaaccccgcacggcagcaggtc
ccgggtcgtggccaccgcttccagcctgcagggcccgccacgcacacgtggtgcgacctc
tgcggagacttcatctggggcgtcgtgcgcaagggcctacagtgcgcgcactgcaagttc
acctgccactaccgttgccgcgcgctcgtctgcctggattgctgcgggccccgggacctg
ggctgggaccccgcgctggagcgggacacgaacgtggatgagcctgtggagtgggagaca
cctgacctttctcaggctgagattgagcagaaaatcaaggagtacaatggacaaatcaac
agcaacctcttcatgagcctgaacaaggatggctcctacacaggcttcatcaaagttcag
ctaaagctggtgcgccctgtctcagtgccctccagcaagaaaccaccttccttacaagat
gcccggcggggctcaggacggagcacagctgtgaggcgccgcacctccttttatctgccc
aaagacactatcaagcacctgcatgttttgtcacgcacaagggcacgtgaggtcattgag
gccctgcttcgaaaattcttggtggttgatgatccccgcaaatttgcactctttgaacga
gctgagcgtcatggccaagtgtatttccggaagctgtcagatgatgagcagcccttgagg
ttacgacttctcgcagggcccagtgagaaagccctgagctttgtcctgaaggagaatgac
tctggggaggtgaattgggatgccttcagcatgcctgaactacataacttcctgcgcatc
ctgcagcgagaggaagaggaacaccttcgtcagatcctgcagaagtattcccgttgccgt
cagaagatccaagaggccctgcacgcctgccccttggggtga

DBGET integrated database retrieval system