KEGG   Castor canadensis (American beaver): 109693747
Entry
109693747         CDS       T04791                                 

Gene name
Tpp2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccan01002]
    109693747 (Tpp2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccan03110]
    109693747 (Tpp2)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     109693747 (Tpp2)
Peptidases and inhibitors [BR:ccan01002]
 Serine peptidases
  Family S8: subtilisin family
   109693747 (Tpp2)
Chaperones and folding catalysts [BR:ccan03110]
 Intramolecular chaperones
  Subtilisin family
   109693747 (Tpp2)
SSDB
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Other DBs
NCBI-GeneID: 109693747
NCBI-ProteinID: XP_020030873
UniProt: A0A250Y7D9
LinkDB
Position
Unknown
AA seq 1249 aa
MATATTEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPASWINPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGEAWRACIDSNEDGNLSKCTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANKVDYTVHSVRR
ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANRLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVSESSHYDLAFTDVHFKPGQIR
RHFVEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKSWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
ERLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKASNLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE
FTEALRDLKIQWMTKLDSSDIYNELKETYPTYLPLYVARLHQLDAEKERMKRLTEIVEAA
NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQV
HDGAAAGDAEVKEEEGESTLDSLSETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLK
FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggccaccgccacgaccgaggagcccttccctttccacggtctcttgccgaagaaagag
actggggccgcctccttcctctgccgctacccagagtatgacgggcggggagtgctcatc
gccgttctggacacgggggtcgaccccggggccccgggcatgcaggttacaactgatgga
aaaccaaaaatcattgatatcattgatacaacaggaagtggtgacgtgaatactgctaca
gaagtagagccaaaagatggtgaaattattggtctctcaggaagagtgcttaagattcct
gcaagctggataaatccttcaggcaaatatcatattggcattaaaaatggttatgacttc
tatccaaaggctctcaaggaaaggatacagaaagaacgaaaggaaaaaatctgggatcct
gttcacagagtggcccttgcagaagcctgtagaaaacaggaagaatttgatgttgccaac
aatggctcttctcaagcaaataaactaatcaaggaagagcttcaaagtcaagtagaatta
ctaaattcctttgagaaaaaatacagtgatcctggacctgtatatgactgtttggtatgg
catgatggtgaagcctggagagcctgcattgattcaaatgaagatggaaacttgagtaaa
tgcactgtcttgagaaactacaaagaggcccaagaatatggctcttttggtacagccgag
atgttgaattattctgttaatatttatgatgatggaaacctgctctccattgtgaccagt
ggaggagctcatggtacccacgtagccagtatagctgctgggcattttccagaagagcct
gaaaggaatggagtagctcctggtgctcaaattctttccatcaagattggtgacacacgg
ttaagtaccatggaaacaggcacaggccttatcagagcgatgatagaagtcataaatcac
aagtgtgatcttgtcaactacagctatggagaagcaactcactggccaaattctgggaga
atttgtgaagtaatcaatgaagcagtatggaagcataatataatttacgtttcgagcgct
gggaataatggcccgtgcctgtctacagttggttgtccaggtggaactacatcaagtgtg
ataggtgttggtgcttatgtttctcctgatatgatggttgctgagtattcactgagagag
aaattacctgcaaatcaatatacatggtcctctagaggcccaagtgctgatggggccctt
ggtgtgagcatcagtgcaccaggaggagccattgcttctgttcctaactggacattgagg
ggcactcagctgatgaatgggacatctatgtcttcccccaatgcgtgtggaggtattgct
ctgatactttcaggtctgaaagctaataaagttgactatacagttcattcagtcagaaga
gctctagaaaatactgctgtgaaggctgacaatatagaagtatttgcccaaggacatggt
attattcaggttgataaagcctatgactacctcgttcagaacacatcatttgcgaataga
ttaggttttactgttactgtcggaaataaccgtggcatctacctccgagatcctgtccag
gtggctgcaccttcagatcatggcgttggcattgagcctgtatttccagagaacacagaa
aactctgaaaaaatatcccttcagcttcatttagctttaacttcaaattcatcttgggtt
cagtgtcccagtcatttggagctcatgaatcaatgtagacacataaacatccgtgtggat
cccaggggcttaagagaaggattgcattatacagaggtatgtggctatgacatagcatca
cctaatgcaggtcctctgttcagagttccaatcactgcagtaatagcagcaaaagtaagt
gagtcatcacattatgatttagccttcacagatgtgcattttaagcctggtcagattcga
aggcattttgttgaggttcctgagggtgcaacatgggctgaagttactgtctgctcatgt
tcttctgaagtatcagccaagtttgttcttcatgcagtacaacttgtgaagcaaagagca
tatcgaagtcatgaattctacaagttttgttcccttccagaaaaaggaacactgactgaa
gcttttcctgtcctaggtgggaaagcaattgaattttgtattgctcgatggtgggcaagt
cttagtgatgtcaatattgattataccatttctttccatgggatagtatgtactgcgcct
cagttaaacattcatgcatcagaaggaatcaatcgttttgatgttcagtcctccttaaag
tacgaagatttggctccctgcataactttgaagagctgggtccaaacattacgaccagtg
agtgcaaaaacaaaacctttaggatcaagagacgttttgccaaataatcgtcaactttat
gagatggtcctgacatataactttcatcaacccaagagtggagaagtaactccaagctgc
ccacttctttgtgaattgttatacgaatcagaattcgacagccaattatggattattttt
gaccagaacaaaagacagatgggttcaggcgatgcttatccacatcagtattctttgaaa
ttggagaaaggagattatacaattcgactacagattcgtcatgagcaaatcagtgatttg
gagcgtcttaaagatcttccatttattgtttctcataggttatctaataccttgagctta
gatattcatgaaaatcatagcctcgcacttctaggaaagaagaaagcaagcaatttgaca
ttaccacccaagtataaccagccattctttgtcacttccttacctgatgataaaataccc
aaaggggcaggacctggatgctaccttgcaggatccttaacattgtcaaagactgaactt
ggcaagaaagctgatgtgatccctgttcattattacttaatacctcctccgacaaagact
aagaatggcagcaaagataaagaaaaagattcagaaaaagagaaagatttaaaagaagag
tttactgaagcattacgagaccttaaaattcagtggatgacaaagctggattctagtgac
atttataatgaattgaaagaaacatatcctacatatcttcctctgtatgttgcacggcta
catcaattagatgctgaaaaggagcgaatgaaaagacttactgaaattgtcgaagctgca
aatgctgttatttctcacatagaccaaacggctctagcagtttatattgcaatgaagact
gaccctcggcccgatgcagctactataaaaaatgatatggacaaacagaaatctaccctg
gtagatgccctttgcaggaaaggatgtgcactggcagaccaccttcttcacacacaggtt
catgatggagcagcagcaggagatgcagaagtaaaggaagaagaaggagaaagtacttta
gattctctgtcagaaacattttgggaaactacaaagtggactgatctttttgacaataag
gttttgacatttgcatacaaacatgcattagtaaataaaatgtatgggagaggccttaag
tttgcaactaaacttgtggaagaaaaaccaacaaaagaaaactggaaaaactgtattcaa
ctgatgaaattacttggatggacccattgtgcatcttttactgaaaactggctccccatc
atgtatcctcctgattattgtgtattctaa

DBGET integrated database retrieval system