KEGG   Castor canadensis (American beaver): 109694098Help
Entry
109694098         CDS       T04791                                 

Gene name
Thpo
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04060  Cytokine-cytokine receptor interaction
ccan04630  Jak-STAT signaling pathway
ccan04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    109694098 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109694098 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109694098 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccan04052]
    109694098 (Thpo)
Cytokines and growth factors [BR:ccan04052]
 Cytokines
  CSF and other factors
   109694098 (Thpo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 109694098
NCBI-ProteinID: XP_020031414
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MHVFLLICSPECCLLCNWVLELFSSRIVSRPSFSAHPCPTLLCPEVQEAKPPPWPQERFT
GEAPYREPLLPDTLARMELPELLLVVMLLLTARLTLSSPAPPACDPRLLNKLLRDSYVLH
SRLSQCPDVNLLSTPVLLPAVDFSLGEWKTQMEQTKAQDILGAVTLLLEGVMAARRQLGP
TCLSSLLGQLSGQVRLLLGALQGLVGTQLPPQGRTTAHKDPNAIFLNFQQLLRGKVRFLL
LVGGPTLCVRRALPTTTVLNSTSLLLTLNKLPNRTSGWLETNFSVSARTTGSGFLNRLQG
FTAQIPGLLNQTSRSPDQIPGYLNRTQGALNGTHGLFSGASPRTLEASDILPGALDIGSL
PPLLQEGYPPSPAQSPAGQYTLFSSPPTLPTPMPPPQLHPFPDPSAIMPNPTSPLPITAH
PHSQNLSQEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcttcctactcatctgctccccagagtgctgcctgctgtgcaactgggtgctg
gagctcttctccagccggatagtctccagaccctctttctcggcccacccgtgccccacc
ctgctctgcccagaagtgcaagaggccaagccgcctccatggccccaggaaagattcacg
ggagaggccccatacagggagccactcctgccagacaccctggccagaatggagctgcct
gaattgctcctcgtggtcatgcttcttcttactgcaaggctaactctgtccagcccagct
cctcctgcctgtgacccccgactcctaaacaaactgcttcgtgactcctatgtccttcac
agcagactgagccagtgcccagacgtcaaccttttgtccacacctgtcttgctgcctgct
gtagactttagcttgggagaatggaaaactcaaatggaacagaccaaggcacaggacatt
ctgggagcagtgacccttctactggagggagtgatggcagcacggagacagctgggaccc
acctgcctctcatccctcctgggacagctttctgggcaggtccgcctcctccttggggcc
ctgcagggcctcgttggaacccagcttcctccacagggcaggaccacagctcacaaggat
cccaatgccatctttctgaacttccaacaactgctccgaggaaaggtgcgtttcctgctg
cttgtaggagggcccaccctctgtgtcaggcgggccctgcccaccacaactgtcttgaac
agtacctctctactcctcacactgaacaagctcccaaacagaacttctggatggctggag
acaaacttcagtgtctcggccagaactactggctctggatttctgaacaggctgcaagga
ttcacagcccagattcctggtctgctgaatcaaacctccaggtctccagaccaaatccct
ggatacttgaacaggacacaaggagccttgaatggaactcatggactcttttctggagcc
tcccccagaactctagaagcctcagacattctgccaggagctttggacataggctccttg
ccacccctccttcaggaaggatatcccccttcccccgcccaatctcctgctggacagtac
acactcttctcttctccacccaccttgcccacccccatgcctccacctcagctccacccg
tttcctgacccttctgctatcatgcctaaccctaccagccctcttccaatcacagctcac
cctcactcccagaatctgtctcaagaaggctaa

DBGET integrated database retrieval system