KEGG   Castor canadensis (American beaver): 109694185
Entry
109694185         CDS       T04791                                 

Gene name
Il4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04060  Cytokine-cytokine receptor interaction
ccan04151  PI3K-Akt signaling pathway
ccan04630  JAK-STAT signaling pathway
ccan04640  Hematopoietic cell lineage
ccan04657  IL-17 signaling pathway
ccan04658  Th1 and Th2 cell differentiation
ccan04659  Th17 cell differentiation
ccan04660  T cell receptor signaling pathway
ccan04664  Fc epsilon RI signaling pathway
ccan04672  Intestinal immune network for IgA production
ccan05140  Leishmaniasis
ccan05200  Pathways in cancer
ccan05310  Asthma
ccan05320  Autoimmune thyroid disease
ccan05321  Inflammatory bowel disease
ccan05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109694185 (Il4)
   04151 PI3K-Akt signaling pathway
    109694185 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109694185 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109694185 (Il4)
   04660 T cell receptor signaling pathway
    109694185 (Il4)
   04658 Th1 and Th2 cell differentiation
    109694185 (Il4)
   04659 Th17 cell differentiation
    109694185 (Il4)
   04657 IL-17 signaling pathway
    109694185 (Il4)
   04664 Fc epsilon RI signaling pathway
    109694185 (Il4)
   04672 Intestinal immune network for IgA production
    109694185 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109694185 (Il4)
  09163 Immune disease
   05310 Asthma
    109694185 (Il4)
   05320 Autoimmune thyroid disease
    109694185 (Il4)
   05321 Inflammatory bowel disease
    109694185 (Il4)
   05330 Allograft rejection
    109694185 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109694185 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccan04052]
    109694185 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:ccan00536]
    109694185 (Il4)
Cytokines and growth factors [BR:ccan04052]
 Cytokines
  Interleukins
   109694185 (Il4)
Glycosaminoglycan binding proteins [BR:ccan00536]
 Heparan sulfate / Haparin
  Cytokines
   109694185 (Il4)
SSDB
Motif
Pfam: IL4 MOR2-PAG1_C SIL1 PDCD7 C_Hendra Leptin DUF2524 CDT1_C PLC-beta_C
Other DBs
NCBI-GeneID: 109694185
NCBI-ProteinID: XP_020031565
LinkDB
Position
Unknown
AA seq 133 aa
MGLTPQLTAALFCLLACTGNLVHGCNRSLTEIIQTLNTLSEKKNTTEKELLCRATAVLRQ
MYNPQSKVTQCLTGHKDRDVLSRLKQLYRILHSMVQSKNCPVNESMQTTLKNFLESLKRI
MQKKYSQCGSLLS
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcaccccccagctgactgctgctctgttctgcctactagcatgtactggcaat
cttgtccacggatgcaaccgttccttaacagagatcatccaaactttgaatacactctca
gagaaaaaaaacacaacagagaaggaactcctgtgcagggctacagctgtacttcggcag
atgtataacccccagagcaaggtgactcagtgcttgactgggcacaaggaccgggatgtc
ctctctcgcctgaaacaactctacaggatcttacacagcatggttcaatcgaaaaactgt
cctgtgaatgaatccatgcagaccactctgaaaaacttcttggaaagcctaaaaaggatc
atgcagaagaaatattcacagtgtggaagcttattgtcttaa

DBGET integrated database retrieval system