KEGG   Castor canadensis (American beaver): 109694681Help
Entry
109694681         CDS       T04791                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial isoform X1
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00100  Steroid biosynthesis
ccan01100  Metabolic pathways
ccan04928  Parathyroid hormone synthesis, secretion and action
ccan05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109694681
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    109694681
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109694681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccan00199]
    109694681
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     109694681
Cytochrome P450 [BR:ccan00199]
 Cytochrome P450, animal type
  CYP24 family
   109694681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 109694681
NCBI-ProteinID: XP_020032377
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MSSPIRKPSSLAAFLGRLRGLEQPPRPVTSSASTPLPQREVPLCPLMAHGETQNLAALPG
PTKWPLLGSLPDILWKGGLKKQHDTLAEYHKKYGKIFRMKLGSFDSVHLGSPRLLEALYR
TESAYPQRLEIKPWKAYRDYRKESYGLLILEGEDWQRVRGAFQKKLMKPTEVMKLDNKIN
EVLADFMGRIDELCDERGHIKDLYSELNKWSFESICLVLYEKRFGLLQKHTGEEALNFIM
AIKTMMSTFGKMMVTPVEFHKSLNTKVWQDHTLAWDTIFKSVKSSVNTRLEKHSQQPGAD
FLCDIYHHNQLSKKELYAAVTELQLAAVETTANSLLWILYNLSRNPQVQQRLLKEIQSIV
PENRMPGAEDLRKMPYLKACLKESMRITPSVPFTTRTLDKITVLGEYALPKGTVLMLNTQ
VLGSNEDNFEDPHQFRPERWLQTDKKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWII
RKYDIVATDNDPVEMLHLGILVPSRELPIAFCPR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccaatccgcaagccgagctcccttgccgctttcctgggacggctgcgaggc
ctcgagcagccccccagacctgtgacatccagtgcgtccacgccccttccacagcgagag
gtacccctctgcccgctgatggcacatggtgagacgcagaacttggcagccctgcccggc
cctactaaatggccactgctgggcagtctgccggatattctttggaaagggggcctgaag
aaacagcacgacactctggcagagtaccacaagaagtacggcaagatcttccggatgaag
ctgggctccttcgactcggtgcacctgggctcgccgcgtctgctggaagcgctgtatcgc
accgagagcgcgtatcctcagcggctggagatcaaaccgtggaaggcctatcgcgactat
cgcaaggagagctacgggctgctgatcttggaaggagaagactggcagagggtccgcggg
gcttttcaaaagaagctaatgaagccaacggaagttatgaagctggacaacaaaatcaat
gaggtcttggctgatttcatgggcagaatagatgagctctgtgatgaaagaggccatatc
aaagatttatacagcgaactgaacaagtggtcatttgaaagcatctgcctcgtgttatat
gagaagagatttgggctacttcagaagcacacaggggaagaggctttgaacttcatcatg
gccatcaaaacaatgatgagcacgtttgggaagatgatggtcaccccagttgaatttcac
aagagcctcaacaccaaggtctggcaggaccacacattggcctgggacaccatttttaaa
tcagtcaaatcttctgtcaacacccggttagagaaacattctcagcagcctggagcagat
ttcctatgtgacatttatcaccacaatcagctttccaagaaagaattgtatgctgcggtc
acagaactccagctggctgcggtagaaacaacagcaaacagcttactgtggattctctac
aatttatcccgcaacccccaagtgcaacaaaggcttcttaaggaaattcaaagcatagtg
cctgagaatcgaatgcctggtgcagaagacttgaggaaaatgccctatttaaaggcgtgt
ctgaaagaatcgatgaggattacccctagtgtaccattcacaactaggactcttgacaag
atcacagttctgggtgaatatgctttacccaaaggaacagtgttgatgctaaatacccag
gttttggggtccaatgaagacaattttgaagatccacatcagtttagacctgaacgttgg
cttcaaacagataaaaagatcaacccctttgcccatcttccattcggcattggaaaaaga
atgtgcattggacgccgattggctgagctccagctgcacttggctctttgctggatcatc
cgcaaatatgacattgtggccacagacaatgaccctgtggagatgctgcacctgggcatc
ctggtgcccagcagggagctccccatcgctttctgcccacggtag

DBGET integrated database retrieval system