KEGG   Castor canadensis (American beaver): 109695403Help
Entry
109695403         CDS       T04791                                 

Gene name
Aldh2
Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00010  Glycolysis / Gluconeogenesis
ccan00053  Ascorbate and aldarate metabolism
ccan00071  Fatty acid degradation
ccan00280  Valine, leucine and isoleucine degradation
ccan00310  Lysine degradation
ccan00330  Arginine and proline metabolism
ccan00340  Histidine metabolism
ccan00380  Tryptophan metabolism
ccan00410  beta-Alanine metabolism
ccan00561  Glycerolipid metabolism
ccan00620  Pyruvate metabolism
ccan01100  Metabolic pathways
Module
ccan_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109695403 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    109695403 (Aldh2)
   00620 Pyruvate metabolism
    109695403 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109695403 (Aldh2)
   00561 Glycerolipid metabolism
    109695403 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109695403 (Aldh2)
   00310 Lysine degradation
    109695403 (Aldh2)
   00330 Arginine and proline metabolism
    109695403 (Aldh2)
   00340 Histidine metabolism
    109695403 (Aldh2)
   00380 Tryptophan metabolism
    109695403 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109695403 (Aldh2)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109695403 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 109695403
NCBI-ProteinID: XP_020033514
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MLRAAALAAAGLGPRLGRRLLSAAATQAVPTPNQQPEVFYNQIFINNEWHDSISKKTFPT
VNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASERGRLLYRLADLIERDR
TYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLVKEAGFPPGVVN
IVPGYGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYXEFVERSVARAKSRVVGNPFDSQT
EQGPQVDETQFKKILGYIKSGKQEGAKLLCGGEAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKSS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgccgctctcgccgccgccggcctcgggccccgcctgggccgccgcctc
ctgtcggccgcagccacccaggccgtcccgacccccaaccagcagcctgaggtcttctac
aaccagatcttcataaacaatgaatggcatgactcaatcagcaagaaaacgttccccact
gtcaatccatccactggagaggtcatctgtcaggtagcagaagggaacaaggaagatgtg
gacaaggcagtgaaggctgccagggctgccttccagctgggctcaccctggcgccgcatg
gatgcatcggagaggggccgactgctgtaccgcctggctgatctgatcgagcgagaccgg
acctacctggcagccttggagaccctggacaacggcaagccttacatcatctcctacctg
gtggatttggacatggtcctgaaatgtctacgttattatgctggctgggccgataagtac
catgggaaaaccattcccattgatggagacttcttcagctacacccgccatgagcctgtg
ggggtgtgtgggcagattattccgtggaacttcccgctcctgatgcaagcatggaaactg
ggcccagccttggcaactgggaacgtggttgtgatgaaggtcgctgagcagacgcctctc
actgctctctacgtggccaacttggtcaaggaggccggctttcctcctggtgtggtcaac
attgttcctgggtatggccccaccgctggggctgctattgcctcccacgaggatgtggac
aaagtagcattcacagggtccacagaggttggccatctgatccaggttgctgcagggagc
agcaatctcaagagagtgaccctggagctggggggcaagagtcccaacatcatcatgtca
gatgctgatatggactgggctgtggaacaggcccacttcgccctgttcttcaaccagggc
cagtgctgttgcgctggctcccggacctttgtgcaggaaaatgtgtacngagagtttgtg
gaacggagtgttgcccgggccaagtctcgggtagtcggaaacccctttgacagccagact
gagcaggggccacaggtggatgaaactcagtttaagaagattcttggttatattaaatcc
gggaagcaagagggggcaaagctgctgtgtggtggagaggccgctgctgaccgtggctac
ttcatccagcccactgtgtttggagatgtgcaagatggcatgaccattgcgaaggaggag
atctttgggccagtgatgcagattctgaagttcaagaccatagaggaggttgttggcaga
gccaacaattccaagtatgggctggccgcagctgtcttcacaaaggacttagacaaggcc
aattatctatcccaagccctccaggctggcactgtgtgggtcaactgctatgatgtattt
ggggcccaatccccatttggtggctacaagatgtctgggagtggccgagagctgggcgag
tatggtctgcaggcatacactgaagtgaagacggtcacaatcaaggtgcctcagaagagc
tcatag

DBGET integrated database retrieval system