KEGG   Castor canadensis (American beaver): 109695415Help
Entry
109695415         CDS       T04791                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00052  Galactose metabolism
ccan00500  Starch and sucrose metabolism
ccan01100  Metabolic pathways
ccan04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109695415
   00500 Starch and sucrose metabolism
    109695415
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109695415
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109695415
    3.2.1.20  alpha-glucosidase
     109695415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 109695415
NCBI-ProteinID: XP_020033541
LinkDB All DBs
Position
Unknown
AA seq 331 aa AA seqDB search
MCTTSPHSDSLCPPPGCAVLRHRLHGAAAGLHPQPQVFWIARSDQSHERQRDAGHPHSGS
SHFWYETEPYPAFTEGVQDDVFIKYPDDGGIVWGKVWPDFPDVVVNNSLDWDSQVEQYRA
YAAFPDFFRNSAVQWWKREIGKMYNNTESPEKSLKFDGMWIDMNEPSSFVNGAVPAGCRN
ATLNHPPYMPHVEDRVWASAARPCAWRVSRSCRMVRVRHYDVHSLYGWSQTRPTYEAVQE
VTGERGIIITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGQIFVGS
LKMLNMRCVLAGCSWEPFTPFPGTTMARGTG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaccaccagcccccactctgattccttgtgtcctcccccaggatgtgcagtactc
agacatcgactacatggagcggcagctggacttcaccctcagccccaagttttctggatt
gccagatctgatcaatcgcatgaaagacagagggatgcgggtcatcctcattctggatcc
agccatttctggtatgagacagagccgtatcctgccttcactgagggagtgcaagatgat
gtcttcattaagtatccagatgatggaggaattgtctggggaaaggtctggcctgatttc
cctgacgttgttgtgaacaactctctagactgggacagtcaagtggagcaataccgagct
tatgcggccttcccggactttttccgtaattcagctgtccagtggtggaagagggaaatt
ggaaaaatgtataataatacagaaagtccagagaagagcttgaagtttgatggcatgtgg
attgatatgaatgagccttcaagctttgtgaatggggccgttcctgcaggctgcaggaat
gctactctgaaccatcctccctacatgccgcatgtggaggacagggtgtgggcctcagca
gcaagaccctgtgcatggagagtgagcagatcctgccggatggttcgggtgcggcactat
gatgtgcacagcctgtacgggtggtcccagaccagacccacctatgaagctgtgcaggag
gtgacaggagagcgagggatcatcatcacccgctccacattcccttcttctggccgctgg
gcaggacactggctgggagacaacacagctgcttgggatcagctgaagaaatctatcatt
ggcatgatggagttcagtctgtttggcatctcctatacagggcagatatttgtgggttct
ttgaagatgctgaatatgagatgtgtgctcgctggatgcagctgggagccttttacccct
tttccaggaaccacaatggcgaggggaacagggtag

DBGET integrated database retrieval system