KEGG   Castor canadensis (American beaver): 109695435Help
Entry
109695435         CDS       T04791                                 

Gene name
Mgam2
Definition
(RefSeq) LOW QUALITY PROTEIN: putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00052  Galactose metabolism
ccan00500  Starch and sucrose metabolism
ccan01100  Metabolic pathways
ccan04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109695435 (Mgam2)
   00500 Starch and sucrose metabolism
    109695435 (Mgam2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109695435 (Mgam2)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109695435 (Mgam2)
    3.2.1.20  alpha-glucosidase
     109695435 (Mgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109695435
NCBI-ProteinID: XP_020033563
LinkDB All DBs
Position
Unknown
AA seq 2461 aa AA seqDB search
MAKKLSVLEILLIIFILIVLAVDILLLLLVLEKPSDSSFIPECPEIPQSERIDCTPGQVV
TEEICRWQHKCCWKPDADTNVPRCFFPRNWGYEVHSGPTNTSTGFTAQLKKLPSPSLFGN
DVTDTLFTADYQTSNRFHFKITDFNALRYEVPDEIMDLAQDTDTAYKSNGSYHVEVTHKP
FSIRIMRKSNNRVLLDTSIGPLQFAQQFLQLSFRLPSTNVYGLGEHVHGQYRHNTDWKTW
PIFTRDAIPTAGMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVALQPAPAITYRTIG
GILDFYVFLGNTPEEVVQEYLKLVGRPFLPAYWSLGFQLSRRDYGGINGLREVVTRTREA
EIPYDVQYSDIDYMDRKKDFTIDEQAYSELSDFVQDLHNYGQKYIIITNPGIFKDTNYTA
FTSGSMERIWILESSGFAVGEGYPGESVFPDFSNPKCTDWWKEQFAEFHERLKFDGVWIE
MDELSILLQGSDHKCESNYLNFPPFMPNTSICIPNDLFSLDVLRAMEKIFHDKRNFILSR
STFAGSGKFAAHWLGDNEATWDDLRWSIPSILEFNLFGIPMVGANICGYAKNVTEELCRR
WMQLGAFYPLSRNHNGPGYRDQDPAAFGFDSLLLNSSRHYLNIRYTLLPYLYTLFYRAHT
LGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYEGVDQVTAYIPDAIWYDYETG
IAIEWRKQFVDLLLPGDRIGLHLRGGYIFPIQQPNTTTETSRKNSLGLIVALDYKREAKG
ELYWDDGVSKAAETNKTYILYDFSVTANRLQAKITNDSYMDPDHLLFTDITILGMDKEPS
NFIVTSNNATTSISSVVYRASTKVVTITDLKGLVLGQEFSIEWNLVVSDLEKFNCYPEDP
TATEESCRQRGCLWELTATPGVPTCYYDTIASYAASNIQYLPMGITTDLALLAAPTSVRA
AAPLSSPAASTVVSDLLSGKISNLKLSVIYHTETMLQVKIYDPINKRYEVPVPLNMPSLP
VGTSENCLYDVKIQTNPFGIKIQRKSSHTVIWDSQLPGFTFDDMFLSISTRLPSQYIYGF
GETEHTTFRRNMSWNMWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMD
VTLQPTPALTYRTVGGILDFYMFLGPTPELVTQQYTELIGRPAMTPYWALGFQLSRYGYQ
NDNEISSLYDEMVAARIPYDVQHVDIDYMNRKLDFTLSSSFQNLSLLIEEMKKNGMRFIL
SLDPAISGNETHYLPFARGQENNVFIKWPDTNDIVWGKVWSELPNVNVDESLDQETQLKL
YRAHVAFPDFLRNSTAVWWKKEIEELHSNPREPEKSLKFDGLWIDMNEPSNFVDGSVEGC
RNEILNNPAYMPYLESRGKGLSSKTLCMESEQILPDGSLVQHYDVHSLYGWSQTRVTYKA
MQEVTGQRGIIITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMEFSLFGISYTGADI
CGFFGNAEYEMCARWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMYSRKALQTRYTLL
PYFYTLMHKAHAEGSTVVRPLFHEFTDDNTTWDIDRQFMLGPAILISPVLESNTFEISAY
FPRGWWYDCSTESGQKSTGMWKTLKAPLDHINLHIRGGHILPWQQPAINTYFSRQNFMGL
TVALDDNGKAEGQMFWDDGQSIDTYENENYFLANFIAAQNILQIQVIHNKYLSHSNPLKV
GYIRIWGMNSSYVTQVCFTYDNQQFMETNFKSDPYNQILTIELTNKNISLERLSEISWVY
GDPPVPTSTIATNYPTNSPYTTEATSAYTIISSASTNTTTNTNTTLLVTTSHYATHTTDV
TPTGTIPDDTTPFFTNTTTNTSTTVPVTTPHYATHTTDVTPTGTIPDDTTPFFTNTSTNT
NTTIPVTTPHYATHTTDVTPTGTIPDDTTPFFTNTTTNTNTTLLVTTPQYATHTTDVTPT
GTIPDDTTPFFTNTTTNTSTTVPVTTPHYATHMTDVTPTRTILDYTTPFFTNATTNTSTT
VPVTTPHYATHTTDVTPTGTIPDDTTPFFTNTTINTSTTVPVTTPHYATHMTDVTPTGTI
LDYTTPFFTNTTTNTSTTLTXCXCSTAFPNVTIPSSTNTTNTSSRTNNSFVSPPSHITTD
DTNPDNTLANTTTVTKTNAASTSNSFSVMITSFSENTDAMDTTVVMVVTSPISTDXXVIK
IRNDSSITNLLSPTTSRGDSTSNTIPSTNTFFDNIAPIVTSSPSSNTDSFHTSHTVPVMA
TDHCTPLITPTXCFTSIINSTTIFSMLPANNMSTTDIVPNFTTSTNXNITNLNTLDTKST
TILEATTVTTSIKDITMSPDITTFTDKFTTYTKSTATELTSTFSPEGTTTSSINATNTMM
LTSANNSSXCTGNSIHIFIPDATTTSDTVTAAVLDMENHHLVISNSTVSYLPILETSATQ
I
NT seq 7386 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaactcagtgtattggaaatccttctgatcatcttcatcctaattgtattg
gctgtagatatcctcttgctgcttcttgtgttggagaaaccctcagattcttcatttatt
ccagagtgcccagagattcctcagtcagaaaggatagactgcacacctggccaggtggtg
acagaggaaatctgcagatggcaacataaatgctgctggaagcctgatgcagacaccaat
gttcctaggtgcttcttccccaggaactggggttatgaagtccacagtggccctacaaat
acaagcacagggtttactgcccagttgaaaaagttgccatccccatctctgtttggaaat
gatgtcactgataccctcttcacagctgattatcagacatccaatcgctttcattttaag
atcactgattttaatgcactgcgctatgaagtccctgatgaaatcatggatctggctcaa
gatactgatactgcttataaatccaatgggagctatcacgtagaagtcactcataagccc
tttagcatcagaataatgcggaaaagcaacaatagagtcttgttggacacaagcattggg
cccctccagtttgcccaacagttcctgcagttgtctttccgactgcccagcaccaatgtg
tatgggctgggagaacacgtgcacgggcagtacagacacaacacggactggaagacctgg
cccatcttcaccagggacgctatccccactgcgggcatgattaacttgtatggagcacat
acatttttcttgtgccttgaagataccagtgggtcatcttttggagtttttctgatgaat
agtaatgccatggaggttgcccttcagcctgctcctgcgatcacttaccgcacgattggg
ggcattcttgacttttatgtgttcctggggaacactccagaggaagtggttcaggaatat
ctgaagcttgttggacgaccatttttacctgcctactggagtcttgggttccagcttagt
cgcagagattatggtggcattaatggattgagagaagttgtaacccgaactcgtgaagct
gagatcccatatgatgtgcaatattcagacatagactacatggatagaaagaaggatttc
actattgatgaacaggcttactctgagctctcagattttgttcaggacttacacaactat
ggacagaaatatatcattattacgaatcctggcatcttcaaagacactaactataccgct
tttaccagtggaagcatggagagaatatggatcttggagagcagtggctttgctgttggg
gagggatatccgggggagtcagtctttcctgactttagcaacccaaagtgtactgattgg
tggaaggagcagtttgctgaatttcatgaacgtctgaagtttgatggagtatggattgaa
atggatgaattatccatcttgctccaaggttctgatcataagtgtgaatcaaactacttg
aactttcctccttttatgcctaatacaagcatctgcatacctaatgaccttttctctttg
gatgtcttacgggccatggagaaaatcttccatgataaaaggaactttatcttatctcgt
tctacttttgctggatctggcaaatttgctgctcattggctgggggacaatgaggccaca
tgggatgacctccgatggtccattcccagtatccttgagttcaacctgtttggcattcct
atggtaggtgccaacatctgtggctatgcaaaaaatgtcacagaggagctctgcagaaga
tggatgcaacttggagcattttatccactatcaaggaatcacaatgggcctgggtatagg
gatcaggatcctgctgcctttggttttgactctctgctgttgaattcctccagacattat
ctgaacatccgctataccctactgccctacctctacaccctcttctaccgagcccacact
ctgggggagacggtagcaaggcccctggttcatgagttctaccaggacccagccacatgg
gaagtgcacgagcagttcttatgggggcctggactcctcatcacacctgttttatatgaa
ggtgtggaccaagtgacagcatacatcccagatgccatctggtatgactatgagacagga
atagccattgaatggaggaaacaatttgtggatttgttacttcctggcgataggataggg
cttcaccttcgaggcgggtacatatttcccatccagcagccaaacacaaccacagagacc
agccggaagaattccctgggactcattgtcgccttggactataagagagaagcaaaggga
gagttgtactgggacgatggtgtgtctaaagctgctgaaactaacaagacttacattctg
tatgatttctcagttactgctaaccgtttgcaggcaaaaattacaaatgatagctatatg
gatcctgaccacctcctgtttacggatatcacaatcttggggatggacaaggagccatct
aacttcattgtcacatctaataatgctaccacttccatttcaagtgtcgtctacagagcc
tcaacaaaggtggtgaccataactgatctcaagggactggtactaggacaagaattctct
attgagtggaatctagtggttagtgacctggagaagttcaattgctaccctgaggatcct
actgccactgaggagagttgcaggcagcggggctgcctttgggagcttacagctacacct
ggtgtgcccacctgctactatgacactattgcctcctatgctgccagtaacattcagtac
ctgcccatgggcatcacaacggaccttgcccttctggcggccccgacatctgtacgagca
gcagctccattgtcgtcaccagcagcatccactgttgtctctgatcttctttctggaaag
attagcaacctcaaactgagtgtgatctaccacacagagaccatgctgcaggtcaagatc
tatgatcccattaataaaaggtatgaggttccagtacctctgaacatgccttctttacca
gttggcacctctgaaaactgcctgtatgatgtcaagattcagactaatccttttggcatc
aagatccaacgcaaaagctcccacactgtgatctgggattctcagctccctggtttcacc
ttcgacgacatgttcctttccatttctactcgcctcccctctcaatacatctatggtttt
ggggaaactgagcatacaactttcagaagaaacatgagctggaacatgtggggaatgttt
gctcgtgatgagccaccagcgtacaagaagaattcctatggcgttcatccctactatatg
gcattggaagaggatggcagtgcccatggggttcttctgctgaacagtaatgctatggat
gtgacacttcagcccactcctgctctgacataccgcactgtaggagggattttggacttt
tatatgtttttgggaccaactcctgaacttgtaactcagcaatacactgagttgattggt
cggccagcaatgactccatactgggccttgggattccagctgagtcgatatggataccag
aatgataatgaaatctccagtttgtatgatgaaatggtggcagcccgtattccctatgat
gtgcaacatgtagacatcgattacatgaaccggaagctggacttcactctcagctctagc
tttcaaaacctcagtctcctgattgaagaaatgaagaaaaatggcatgagatttattctc
agtctggacccggccatttctggcaatgagacacactatctcccattcgctagaggacag
gaaaacaatgtgttcatcaaatggcctgacaccaacgatattgtctggggaaaggtttgg
tcagagctgcccaatgtgaatgtggatgaatctcttgaccaggagactcagcttaagctg
tacagggcccacgtggcttttcctgacttcttacgtaatagcacagctgtctggtggaag
aaagagatagaagagctacattcaaaccctcgggagccagagaagagcttgaagtttgat
ggactatggattgatatgaatgaaccgtcaaactttgtggatggatctgttgagggttgc
cgaaatgaaattcttaataacccagcctatatgccatacttggaatctagaggcaaaggc
ctcagcagcaagaccctgtgcatggagagtgagcagatcctgccagatggctccctggtg
cagcactatgatgtgcacagcctgtacgggtggtcccagaccagagtcacctacaaagcc
atgcaggaggtgacaggacagcgagggatcatcattacccgctccacattcccctcttct
ggacgctggggaggacactggctgggagacaacacagctgcgtgggaccagctagggaaa
tctatcattggcatgatggagttcagtctctttggaatatcttatacaggagcagatatc
tgtgggttctttggaaatgctgagtatgagatgtgtgctcgctggatgcaactgggggca
ttttatccattttccaggaaccacaacaacattgggacaaggagacaagatcctgtggcc
tggaattcaacctttgagatgtactcaagaaaagccctgcagaccagatacacccttctg
ccttatttctacacgctgatgcacaaagcccatgctgaaggcagcactgtggtccgacct
cttttccatgagtttacagatgacaatacaacgtgggatatagaccgccagttcatgttg
ggccctgccatcttgatcagccctgtgctggaaagtaacacctttgagatcagtgcttac
ttccccagaggctggtggtatgactgtagcacagagtctggccaaaaatcaacaggcatg
tggaaaaccctgaaggctcctcttgaccacatcaaccttcatattagagggggtcatatc
ctgccctggcaacaacctgcaatcaatacttacttcagccgacaaaattttatgggattg
actgttgctttggatgacaatgggaaggccgaaggtcagatgttctgggatgatggacaa
agtatcgatacctatgaaaatgaaaattattttttggctaactttatagcagctcagaac
atcttgcaaatacaggtcatacacaataagtatttgagtcactcaaatccactgaaagtt
ggatatattagaatctggggcatgaactcttcttatgtgacacaagtctgtttcacctat
gacaatcagcaattcatggagaccaatttcaaaagtgacccttataatcagatactaact
attgaattgactaacaagaatatcagcctggaaagattaagtgagattagttgggtttat
ggtgatcctccagttcccacttcaactatagcaactaactatcccacaaattctccatat
actactgaggctactagtgcttatactattattagctctgccagtacaaatactactacc
aacactaatactacccttcttgtcacaacctctcattatgcaacacacactactgatgtc
acacccactgggactattcctgatgacaccactcctttctttacaaatactactaccaac
actagtactactgttcctgtcacaacacctcattatgcaacacacactactgatgtcaca
cccactgggactattcctgatgacaccactcctttctttacaaatactagtaccaacact
aatactaccattcctgtcacaacacctcattatgcaacacacactactgatgtcacaccc
actgggactattcctgatgacaccactcctttctttacaaatactactaccaacactaat
actacccttcttgtcacaacccctcagtatgcaacacacactactgatgtcacacccact
gggactattcctgatgacaccactcctttctttacaaatactactaccaacactagtact
actgttcctgtcacaacccctcattatgcaacacacatgactgatgtcacacccaccagg
actattcttgattacaccactcctttctttacaaatgctactaccaacactagtactact
gttcctgtcacaacacctcattatgcaacacacactactgatgtcacacccactgggact
attcctgatgacaccactcctttctttacaaatactactatcaacactagtactactgtt
cctgtcacaacccctcattatgcaacacacatgactgatgtcacacccaccgggactatt
cttgattacaccactcctttctttacaaatactactaccaatactagtactacccttact
taatgttgatgtagtactgcttttcccaatgtaacaattccttccagtacaaatactact
aataccagcagtaggactaataattcttttgtatcccctccctctcatataactactgat
gatactaaccctgataatactcttgcaaatacaactactgttacaaagaccaatgctgct
tctactagcaatagtttttctgttatgattacttctttctctgaaaatactgatgctatg
gacactactgttgttatggtagttacttctcctataagtactgattaataagttattaaa
attagaaatgattcttctattacaaatctgctgtcccctacaacatctcgtggtgacagt
actagtaatactattccttctacaaatactttttttgataatattgctcctatagtgact
tcttctccttcttcaaatactgattcctttcatacaagtcatactgttcctgtcatggca
actgatcactgtactcctctcataactcctaccntttgcttcacttctattatcaactct
actactattttcagcatgcttccagcaaataatatgtccactactgatatagttcctaat
tttacaacctccactaatntaaatatcactaatttaaacacactggatacaaaaagtaca
acaatattagaggccaccactgttactaccagcatcaaagacattaccatgagcccagat
ataacaactttcacagacaagttcactacatacaccaaatctactgccacagagcttaca
agcactttctcaccagaaggaacaactacttcctccatcaatgccactaatactatgatg
ctaacttctgcaaataactccagcnnatgcacaggtaacagcatacacatttttattcca
gatgccacaacaacctcagacacagtaacagctgctgttctagatatggaaaatcaccat
ctggtcatatcaaattctacagtcagttatttacctattcttgaaactagtgctacacag
atctaa

DBGET integrated database retrieval system