KEGG   Castor canadensis (American beaver): 109695689
Entry
109695689         CDS       T04791                                 

Gene name
Zbtb49
Definition
(RefSeq) zinc finger and BTB domain-containing protein 49
Organism
ccan  Castor canadensis (American beaver)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_6 zf-met GAGA Zn-ribbon_8 zf-C2H2_11 zf-H2C2_5
Other DBs
NCBI-GeneID: 109695689
NCBI-ProteinID: XP_020033944
LinkDB
Position
Unknown
AA seq 764 aa
MDPVATHSCHLLQQLHEQRIQGLLCDCMLVVRGVCFKAHKNVLAAFSQYFRGLFQNSSSQ
KSDVFHLDVKSVSGIGQILDFMYTSRLDLNQDNVQAMLDTARCLQVQIVLSLCHTFLKST
SAQQPSGLPCASAFSLQGALTPESTCVMSEHYPPPLLQECSAEAQHGKVLDGSHSQAPSV
SLHHSTGEMAKAAPGALDGSCTELPCKQPNYYYKLRDFYSKQYYKQAACPSHERVAEQPF
TFSASADLAAVETQPCAVSHPECLLESSEHLPSTFLAPPLSDSAPDPESDAPCQPPTKQM
RLKKAVHLKKLNFLKSQKSAEPASEPKVDDGLAKRTEPTSEQTGEKASSQSTEEKESQEL
GSENFSCAVSGTEVPEASAAPEDQSQSLQCQRQYACELCGKPFKHPSNLELHKRSHTGEK
PFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPHLC
DTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSACG
KCFGGSGDLRRHVRTHTGEKPYTCEICDKCFTRSAVLRRHRKMHCKADAGSPDVLDELGQ
AIETSDLDKSQSSDSFPQDMAVTLMPGSVKLPGHPGENATAEFDEHSANSYCKLRSVLHP
PGVSDQEKLSLDPTKLAKPQVPQSQPQVYTYSDTDTSAGSEPLPADGMAMIRSSLATLDS
HCSDPLGSRVSSTAYRNSEGQFFSSMTLWGLAMKTLQNENDLDQ
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggaccctgttgctacccacagctgccacctcctccagcagctgcatgagcagcgaatc
caaggcctgctttgtgactgcatgctggtggtgaggggagtctgcttcaaagcgcacaag
aatgtgctggccgccttcagccagtacttcaggggcctctttcagaactcctcgagccag
aagagtgatgtcttccacttggacgttaagagcgtcagcggcattgggcagatcctggac
ttcatgtacacctctcgcctggatctcaaccaggacaatgtgcaggcgatgctggatacg
gcccggtgtctgcaggtgcagatcgttctgagcctgtgccacacatttctcaagtccacc
tctgcacaacagccttctggcttgccctgtgctagtgccttctccctgcagggtgcgctg
acccccgaaagcacctgtgtgatgagcgaacactatccccctcccttactgcaggagtgt
tcagctgaggcccagcatgggaaggttctggatggatcgcattctcaggctccatctgtc
agtcttcatcactccacaggggaaatggcaaaggcagccccaggtgctttagatggcagc
tgcacagagctgccttgcaaacagcccaattactattacaaactccgagacttttacagc
aagcagtactacaaacaagctgcttgtcccagccacgagcgagtcgccgagcagcccttc
actttcagtgcctctgcagacctcgctgccgtggaaacgcaaccttgtgctgtcagtcat
cccgaatgtctcctggagtcttcggaacacttgccttccaccttcttggccccaccactg
agtgactctgccccagaccctgagtcggacgccccctgtcagccacctaccaaacagatg
aggctcaaaaaggctgttcacctgaagaaattaaatttcctcaagtcacagaaatcagcc
gagccagcatctgagcctaaggtagatgatggattagcaaagaggacggaacccaccagt
gaacagacaggagagaaagccagcagccaaagcaccgaagaaaaagaaagccaggaactc
ggttctgagaattttagttgtgctgttagtggaacggaggtgcctgaggcctcagctgca
ccggaggaccagtcccagtcccttcagtgccagagacagtatgcgtgtgaattgtgtggg
aaacctttcaaacatccaagcaatttggagcttcacaaacggtctcatacaggtgagaaa
ccttttgagtgtaacatttgtgggaaacatttctctcaggcaggtaacttgcaaactcac
ctccgccggcattctggtgaaaagccatacatctgcgagatctgtggaaagaggttcgca
gcctctggtgacgtccagcggcacattatcattcactcgggagaaaagccgcacttgtgt
gacacctgtggccgaggcttcagcaacttcagtaacctgaaggagcacaagaagacgcac
acggccgacaaggtcttcacctgtgacgagtgtggaaagtccttcaacatgcagcggaaa
ctggtgaagcaccgcatccggcacacgggggagcggccctacagctgctctgcctgcggg
aaatgttttggaggctcaggtgacctgcgcaggcacgtccgtactcataccggggaaaag
ccatacacgtgtgagatctgtgacaagtgcttcacccgctctgctgtgctccggcggcac
aggaagatgcactgcaaagctgatgctgggagcccagatgtgctggatgagctcggtcag
gccattgagacctccgacctggacaagtctcagagctctgattccttcccccaggacatg
gccgtgaccttgatgccagggtcggtaaagctccctgggcacccaggagaaaatgccaca
gcagaatttgatgagcactccgccaactcttactgtaagctacgctctgtgctccaccct
cctggggtgagcgaccaggagaaactgagcctggatcccactaagcttgccaagcctcag
gtgccgcagagccagccccaggtgtacacttactcagacacagacacctcagctggcagt
gagcccctgccggctgatggcatggccatgatccgctcctccctggccactctggacagt
cactgcagtgatcctctgggcagccgtgtgtcctccacagcttacaggaactcagagggg
cagtttttctccagcatgaccctctgggggctagcgatgaagacactgcagaatgagaat
gacttggaccagtga

DBGET integrated database retrieval system