Castor canadensis (American beaver): 109696247 Help Entry 109696247         CDS       T04791                                  Symbol Ppp3r2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04020   Calcium signaling pathway ccan04022   cGMP-PKG signaling pathway ccan04114   Oocyte meiosis ccan04218   Cellular senescence ccan04310   Wnt signaling pathway ccan04360   Axon guidance ccan04370   VEGF signaling pathway ccan04380   Osteoclast differentiation ccan04625   C-type lectin receptor signaling pathway ccan04650   Natural killer cell mediated cytotoxicity ccan04658   Th1 and Th2 cell differentiation ccan04659   Th17 cell differentiation ccan04660   T cell receptor signaling pathway ccan04662   B cell receptor signaling pathway ccan04720   Long-term potentiation ccan04724   Glutamatergic synapse ccan04921   Oxytocin signaling pathway ccan04922   Glucagon signaling pathway ccan04924   Renin secretion ccan05010   Alzheimer disease ccan05014   Amyotrophic lateral sclerosis ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05031   Amphetamine addiction ccan05152   Tuberculosis ccan05163   Human cytomegalovirus infection ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05170   Human immunodeficiency virus 1 infection ccan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109696247 (Ppp3r2)    04310 Wnt signaling pathway     109696247 (Ppp3r2)    04370 VEGF signaling pathway     109696247 (Ppp3r2)    04020 Calcium signaling pathway     109696247 (Ppp3r2)    04022 cGMP-PKG signaling pathway     109696247 (Ppp3r2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109696247 (Ppp3r2)    04218 Cellular senescence     109696247 (Ppp3r2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109696247 (Ppp3r2)    04650 Natural killer cell mediated cytotoxicity     109696247 (Ppp3r2)    04660 T cell receptor signaling pathway     109696247 (Ppp3r2)    04658 Th1 and Th2 cell differentiation     109696247 (Ppp3r2)    04659 Th17 cell differentiation     109696247 (Ppp3r2)    04662 B cell receptor signaling pathway     109696247 (Ppp3r2)   09152 Endocrine system    04922 Glucagon signaling pathway     109696247 (Ppp3r2)    04921 Oxytocin signaling pathway     109696247 (Ppp3r2)    04924 Renin secretion     109696247 (Ppp3r2)   09156 Nervous system    04724 Glutamatergic synapse     109696247 (Ppp3r2)    04720 Long-term potentiation     109696247 (Ppp3r2)   09158 Development and regeneration    04360 Axon guidance     109696247 (Ppp3r2)    04380 Osteoclast differentiation     109696247 (Ppp3r2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109696247 (Ppp3r2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109696247 (Ppp3r2)    05170 Human immunodeficiency virus 1 infection     109696247 (Ppp3r2)    05163 Human cytomegalovirus infection     109696247 (Ppp3r2)    05167 Kaposi sarcoma-associated herpesvirus infection     109696247 (Ppp3r2)   09171 Infectious disease: bacterial    05152 Tuberculosis     109696247 (Ppp3r2)   09164 Neurodegenerative disease    05010 Alzheimer disease     109696247 (Ppp3r2)    05014 Amyotrophic lateral sclerosis     109696247 (Ppp3r2)    05020 Prion disease     109696247 (Ppp3r2)    05022 Pathways of neurodegeneration - multiple diseases     109696247 (Ppp3r2)   09165 Substance dependence    05031 Amphetamine addiction     109696247 (Ppp3r2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109696247 (Ppp3r2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccan01009]     109696247 (Ppp3r2) Protein phosphatases and associated proteins [BR:ccan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109696247 (Ppp3r2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  109696247 NCBI-ProteinID:  XP_020034817 UniProt:  A0A8B7VT59 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNESSYPSEMCSHFDHDEIKRLGKSFKKIDLDKSGALSVDEFMSLPYLQQNPLVKRVID VFDTDGNGEVDFQEFIVGTSQFSVKGDEDQKLRFAFRIYDIDKDGFISNGELFQVLKMMV GDNLKDWQLQQLVDKTIIVLDKDGDGKISFEEFCAVVKGMEIHKKLVVVV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaatgagtccagttatccctcggagatgtgctcccacttcgatcacgatgagatt aaaaggctgggcaagagcttcaagaagatcgacttggacaagtctggtgcgctgagcgtg gatgagttcatgtccctgccctacctgcagcagaacccgctggtgaagcgagtgatcgat gtcttcgacaccgacggtaatggcgaggtagacttccaggagttcatcgtgggaacctcc cagttcagcgtcaaaggagacgaggaccagaagttgcggttcgctttccgcatctacgac attgacaaagatggcttcatttccaacggggaactcttccaggtgctcaagatgatggtg ggggacaacctcaaggactggcagctgcagcagctcgttgacaaaacaattatcgtcctg gataaagatggcgatgggaaaatatcctttgaggaattctgcgcggtggtcaaaggcatg gagatccacaagaagttggtagtggttgtgtga

DBGET integrated database retrieval system