KEGG   Castor canadensis (American beaver): 109696272Help
Entry
109696272         CDS       T04791                                 

Gene name
Kmt5c
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase KMT5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109696272 (Kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109696272 (Kmt5c)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109696272 (Kmt5c)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109696272 (Kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109696272
NCBI-ProteinID: XP_020034864
LinkDB All DBs
Position
Unknown
AA seq 465 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFCTHKMNVSPMPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHVFRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEXLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLQDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLQPRDPQLPPQPLDKYQLRETKRRLQQGLDSSQQSLLSPRACTHLSLLRRDPFCAAC
QPLHLPPGSSRLDNSPLWLQWLPQPQLRARPRKRRRPRPQRAPVLPVLRAACVSLHRWGG
CGPNCRLQAEAVVALGLPPHARWAPQQDWHWARRYGLPYVVRVDLNRLAPAPPAAPTSTG
TLSPVSIPIPIPKQALAFTPFSTPKRLRLVVSHGSIDLDINSDEP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgacagagtgacagcccgagaactgtgtgagaacgatgacctagccaccagc
cttgtcctcgacccctacctcggcttctgtacccataagatgaacgtcagccctatgccc
cccctgcggcgacagcaccaccttcgctcagcactggaagctttcctgaggcagagggac
ctggaggctgcttaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggccctcgccaggaggctgccctcaagacccacgtgtttcgctacctccgcgccttc
ctgcctgaaagtggcttcaccatcctgccgtgcacccgctactccatggagaccaacggg
gccaagatcgtgtccacccgtgcttggaaaaagaacgagaagctggagctgctggtgggc
tgcatcgcagagcttcgggaggcagatgagnggctgctgagggccggtgagaacgacttc
agcatcatgtactcaacccgcaagcggagcgcccagctgtggcttggcccagctgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaatgctgcctgc
gtaaaggtgctccaggacatcgagccaggggatgaggtgacatgcttctacggcgagggc
ttcttcggtgagaagaacgagcactgtgaatgctacacctgcgagaggaaaggcgaggga
gctttcagactacagccccgggacccccagctgccgccacagcccctggacaagtaccag
ctccgcgaaaccaagcggcgactgcagcaaggcctagacagcagccagcagagcctccta
agcccgcgggcctgcacccatctgtcccttctgcgccgggatcccttctgtgccgcctgt
cagcccctgcacctgccacctggcagttcccgcctggacaactcacctctctggctccag
tggctgccacagccacagctccgagcgcgcccacggaagcgccggcgcccccggccccag
cgggctccagtgctccctgtcctccgtgctgcctgtgtctccctgcaccggtggggaggc
tgtggccccaactgtcgcttgcaggctgaggctgtggtagccctaggccttcctcctcat
gcccgctgggctccccagcaagactggcactgggctcggcgctatgggctgccttatgtg
gtgcgtgtggaccttaatcgcctggccccagccccaccagctgcccctacttctactggg
accctcagccctgtctccatccccatccccatccccaaacaggccctggcctttaccccc
ttctccacacccaagcgcctgcgcctagttgtcagccatggatccattgatctggacatc
aacagtgatgagccttga

DBGET integrated database retrieval system