KEGG   Castor canadensis (American beaver): 109696351
Entry
109696351         CDS       T04791                                 

Gene name
Ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01522  Endocrine resistance
ccan04068  FoxO signaling pathway
ccan04110  Cell cycle
ccan04115  p53 signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04152  AMPK signaling pathway
ccan04218  Cellular senescence
ccan04310  Wnt signaling pathway
ccan04340  Hedgehog signaling pathway
ccan04371  Apelin signaling pathway
ccan04390  Hippo signaling pathway
ccan04510  Focal adhesion
ccan04530  Tight junction
ccan04630  JAK-STAT signaling pathway
ccan04917  Prolactin signaling pathway
ccan04919  Thyroid hormone signaling pathway
ccan04921  Oxytocin signaling pathway
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan04934  Cushing syndrome
ccan05160  Hepatitis C
ccan05162  Measles
ccan05163  Human cytomegalovirus infection
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05169  Epstein-Barr virus infection
ccan05200  Pathways in cancer
ccan05203  Viral carcinogenesis
ccan05205  Proteoglycans in cancer
ccan05206  MicroRNAs in cancer
ccan05210  Colorectal cancer
ccan05212  Pancreatic cancer
ccan05213  Endometrial cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05216  Thyroid cancer
ccan05218  Melanoma
ccan05219  Bladder cancer
ccan05220  Chronic myeloid leukemia
ccan05221  Acute myeloid leukemia
ccan05222  Small cell lung cancer
ccan05223  Non-small cell lung cancer
ccan05224  Breast cancer
ccan05225  Hepatocellular carcinoma
ccan05226  Gastric cancer
ccan05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109696351 (Ccnd1)
   04340 Hedgehog signaling pathway
    109696351 (Ccnd1)
   04390 Hippo signaling pathway
    109696351 (Ccnd1)
   04371 Apelin signaling pathway
    109696351 (Ccnd1)
   04630 JAK-STAT signaling pathway
    109696351 (Ccnd1)
   04068 FoxO signaling pathway
    109696351 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    109696351 (Ccnd1)
   04152 AMPK signaling pathway
    109696351 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109696351 (Ccnd1)
   04115 p53 signaling pathway
    109696351 (Ccnd1)
   04218 Cellular senescence
    109696351 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109696351 (Ccnd1)
   04530 Tight junction
    109696351 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109696351 (Ccnd1)
   04921 Oxytocin signaling pathway
    109696351 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    109696351 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109696351 (Ccnd1)
   05206 MicroRNAs in cancer
    109696351 (Ccnd1)
   05205 Proteoglycans in cancer
    109696351 (Ccnd1)
   05203 Viral carcinogenesis
    109696351 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109696351 (Ccnd1)
   05212 Pancreatic cancer
    109696351 (Ccnd1)
   05225 Hepatocellular carcinoma
    109696351 (Ccnd1)
   05226 Gastric cancer
    109696351 (Ccnd1)
   05214 Glioma
    109696351 (Ccnd1)
   05216 Thyroid cancer
    109696351 (Ccnd1)
   05221 Acute myeloid leukemia
    109696351 (Ccnd1)
   05220 Chronic myeloid leukemia
    109696351 (Ccnd1)
   05218 Melanoma
    109696351 (Ccnd1)
   05219 Bladder cancer
    109696351 (Ccnd1)
   05215 Prostate cancer
    109696351 (Ccnd1)
   05213 Endometrial cancer
    109696351 (Ccnd1)
   05224 Breast cancer
    109696351 (Ccnd1)
   05222 Small cell lung cancer
    109696351 (Ccnd1)
   05223 Non-small cell lung cancer
    109696351 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109696351 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109696351 (Ccnd1)
   04934 Cushing syndrome
    109696351 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109696351 (Ccnd1)
   05162 Measles
    109696351 (Ccnd1)
   05160 Hepatitis C
    109696351 (Ccnd1)
   05163 Human cytomegalovirus infection
    109696351 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109696351 (Ccnd1)
   05169 Epstein-Barr virus infection
    109696351 (Ccnd1)
   05165 Human papillomavirus infection
    109696351 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109696351 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109696351
NCBI-ProteinID: XP_020034966
UniProt: A0A250XXT4
LinkDB
Position
Unknown
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLHLGSPNNFLSCYRLTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNLDPKATEEEEEEEEETDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtacccagacacc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tccgtgtcctatttcaagtgcgtgcagaaggagatcctgccgtccatgcggaagatcgta
gccacctggatgctggaggtctgcgaagagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctcgagcccctgaagaagagtcgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccatccctctgacg
gccgagaagttgtgcatctacactgacaactccatccggcccgaggagctactgcaaatg
gaattgcttctggtgaacaaactcaagtggaacctggcggccatgacccctcacgatttc
attgagcacttcctctccaaaatgccagaggccgaggagaacaaacagatcatccgcaag
cacgcgcagacctttgtggctctctgtgccacagatgtgaagttcatttctaacccgccc
tccatggtggccgctgggagcgtggtggctgcaatgcagggcttgcacctgggcagcccc
aacaacttcctgtcctgctatcgcctgacacacttcctgtccagagtgatcaagtgcgac
ccggactgcctccgggcctgccaggaacagatagaagccctgctcgagtcgagcctgcgc
caggcccagcagaacctggaccccaaggccacagaggaggaggaggaagaggaagaggaa
accgacctggcctgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system