KEGG   Castor canadensis (American beaver): 109696503
Entry
109696503         CDS       T04791                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01522  Endocrine resistance
ccan01524  Platinum drug resistance
ccan04012  ErbB signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04068  FoxO signaling pathway
ccan04110  Cell cycle
ccan04115  p53 signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04218  Cellular senescence
ccan04630  JAK-STAT signaling pathway
ccan04921  Oxytocin signaling pathway
ccan04928  Parathyroid hormone synthesis, secretion and action
ccan04934  Cushing syndrome
ccan05160  Hepatitis C
ccan05161  Hepatitis B
ccan05163  Human cytomegalovirus infection
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05169  Epstein-Barr virus infection
ccan05200  Pathways in cancer
ccan05202  Transcriptional misregulation in cancer
ccan05203  Viral carcinogenesis
ccan05205  Proteoglycans in cancer
ccan05206  MicroRNAs in cancer
ccan05210  Colorectal cancer
ccan05211  Renal cell carcinoma
ccan05212  Pancreatic cancer
ccan05213  Endometrial cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05216  Thyroid cancer
ccan05217  Basal cell carcinoma
ccan05218  Melanoma
ccan05219  Bladder cancer
ccan05220  Chronic myeloid leukemia
ccan05222  Small cell lung cancer
ccan05223  Non-small cell lung cancer
ccan05224  Breast cancer
ccan05225  Hepatocellular carcinoma
ccan05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109696503 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    109696503 (Cdkn1a)
   04066 HIF-1 signaling pathway
    109696503 (Cdkn1a)
   04068 FoxO signaling pathway
    109696503 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    109696503 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109696503 (Cdkn1a)
   04115 p53 signaling pathway
    109696503 (Cdkn1a)
   04218 Cellular senescence
    109696503 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109696503 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    109696503 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109696503 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    109696503 (Cdkn1a)
   05206 MicroRNAs in cancer
    109696503 (Cdkn1a)
   05205 Proteoglycans in cancer
    109696503 (Cdkn1a)
   05203 Viral carcinogenesis
    109696503 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109696503 (Cdkn1a)
   05212 Pancreatic cancer
    109696503 (Cdkn1a)
   05225 Hepatocellular carcinoma
    109696503 (Cdkn1a)
   05226 Gastric cancer
    109696503 (Cdkn1a)
   05214 Glioma
    109696503 (Cdkn1a)
   05216 Thyroid cancer
    109696503 (Cdkn1a)
   05220 Chronic myeloid leukemia
    109696503 (Cdkn1a)
   05217 Basal cell carcinoma
    109696503 (Cdkn1a)
   05218 Melanoma
    109696503 (Cdkn1a)
   05211 Renal cell carcinoma
    109696503 (Cdkn1a)
   05219 Bladder cancer
    109696503 (Cdkn1a)
   05215 Prostate cancer
    109696503 (Cdkn1a)
   05213 Endometrial cancer
    109696503 (Cdkn1a)
   05224 Breast cancer
    109696503 (Cdkn1a)
   05222 Small cell lung cancer
    109696503 (Cdkn1a)
   05223 Non-small cell lung cancer
    109696503 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109696503 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109696503 (Cdkn1a)
   05161 Hepatitis B
    109696503 (Cdkn1a)
   05160 Hepatitis C
    109696503 (Cdkn1a)
   05163 Human cytomegalovirus infection
    109696503 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109696503 (Cdkn1a)
   05169 Epstein-Barr virus infection
    109696503 (Cdkn1a)
   05165 Human papillomavirus infection
    109696503 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109696503 (Cdkn1a)
   01522 Endocrine resistance
    109696503 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109696503
NCBI-ProteinID: XP_020035160
UniProt: A0A250YAQ5
LinkDB
Position
Unknown
AA seq 164 aa
MSDSPRDTRQVPHSSKACRRLFGPVDSEQLRRDYDALMSSHLQEARNRWNFDFVTETPLE
GNFAWEPVRGLGLPKLYLTPGSRGSRDDLGGGKRPGTSTALLQGTAQEDHVDLSLSCTLV
PRSPERPEESPAGPGTSQGRKRRQTSMTDFYHSKRRLVFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtccgattcacccagggacacccgtcaggtcccacacagcagcaaggcatgtcgccgc
ctctttggccctgtggacagcgaacagctacgccgggactatgatgcactcatgtccagc
catctccaggaggcccgtaaccgttggaacttcgactttgtcaccgagacaccactagag
ggcaactttgcctgggagcctgtgcggggcctgggcctgcccaagctgtacctgacccca
gggtcccggggaagcagggatgacttgggaggaggcaagcggccgggcacctccactgcc
ttgctgcaggggacagcacaggaggaccatgtggacctgtcgctgtcctgcacccttgtg
cctcgctcccctgagcggcctgaggagtctccagctgggccaggaacctctcagggccga
aagcggaggcagaccagcatgacagatttctaccactccaaacgccggctggtcttctcc
aagaggaagccctga

DBGET integrated database retrieval system