KEGG   Castor canadensis (American beaver): 109696721Help
Entry
109696721         CDS       T04791                                 

Gene name
Gad1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00250  Alanine, aspartate and glutamate metabolism
ccan00410  beta-Alanine metabolism
ccan00430  Taurine and hypotaurine metabolism
ccan00650  Butanoate metabolism
ccan01100  Metabolic pathways
ccan04727  GABAergic synapse
ccan04940  Type I diabetes mellitus
Module
ccan_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109696721 (Gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109696721 (Gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109696721 (Gad1)
   00430 Taurine and hypotaurine metabolism
    109696721 (Gad1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    109696721 (Gad1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    109696721 (Gad1)
Enzymes [BR:ccan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109696721 (Gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109696721
NCBI-ProteinID: XP_020035475
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLASAFKERQSSKNLLSCENSDREARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMASVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGFVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERASSVTWNPHKMMGVLLQCSAILVRE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGLPDSPERQEKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgactccttcttcgtccgcaacctcctcgaacgctggagcagatcccaat
accaccaatctgcgccccacaacatatgacacttggtgcggcgtggcccatggatgtacc
agaaaactggggctgaagatctgcggctttttgcaaaggaccaacagcctggaagagaag
agccgcctcgcgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgaccgggaggcccggttccgacgcacagagacagacttctccaacctgtttgcc
cgagatctgcttccagcaaagaatggggaggagcaaactgtgcagttcctactggaagta
gtggacatactcctcaactatgtccgtaagacattcgatcgcagcaccaaggtgctggac
tttcaccacccacaccagttgctggaaggcatggagggctttaacttggagctgtctgac
caccctgagtccctggagcagatcctggttgactgcagagacacattgaaatatggagtt
cgaacaggtcatcctcgatttttcaaccagctctccacaggattggatatcattggctta
gccggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgtactcatggagcaaataacacttaagaaaatgagagaaataattggatggtca
agcaaagatggcgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaaaacaaagggcatggcctccgtgccc
aaactggtcctcttcacctcagaacacagtcactactccataaagaaagctggggctgca
cttggctttggaactgacaacgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttggaggcaaaaattcttgaagccaagcaaaagggatttgtccctctttat
gtcaacgcaactgctggcacaactgtttatggagcttttgatccaatacaggagattgca
gatatatgtgagaaatacaacctttggctgcatgtcgatgctgcctggggcggtgggctg
ctcatgtccaggaagcaccgccataaactcagcggcatagaaagggccagctcagtcacc
tggaaccctcacaagatgatgggcgtgctgctgcagtgctccgccattctggtcagggaa
aagggtatactccaaggatgcaaccagatgtgtgcagggtacctcttccagccagacaag
cagtatgatgtctcctatgatactggcgacaaggcaattcagtgtggccgccatgtggac
atcttcaagttctggctcatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgtcttgaactggctgaatacttgtatgccaagattaaaaacagagaagaattt
gagatggtcttcaatggtgagcctgagcacacaaatgtctgcttctggtatattccacaa
agcctcaggggtcttccagatagtcctgagcgacaggaaaaactccacagggtggctcca
aagatcaaagctctcatgatggagtcgggcacaaccatggttggctaccagcctcagggg
gacaaggccaacttcttccgaatggtcatctcaaacccagctgctacccaatctgacatc
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system