KEGG   Castor canadensis (American beaver): 109697299Help
Entry
109697299         CDS       T04791                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00480  Glutathione metabolism
ccan00980  Metabolism of xenobiotics by cytochrome P450
ccan00982  Drug metabolism - cytochrome P450
ccan00983  Drug metabolism - other enzymes
ccan01524  Platinum drug resistance
ccan05200  Pathways in cancer
ccan05204  Chemical carcinogenesis
ccan05225  Hepatocellular carcinoma
ccan05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109697299
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109697299
   00982 Drug metabolism - cytochrome P450
    109697299
   00983 Drug metabolism - other enzymes
    109697299
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    109697299
   05204 Chemical carcinogenesis
    109697299
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    109697299
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    109697299
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    109697299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccan02000]
    109697299
Enzymes [BR:ccan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109697299
Transporters [BR:ccan02000]
 Other Transporters
  Pores ion channels [TC:1]
   109697299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 109697299
NCBI-ProteinID: XP_020036416
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MSGVSARSLAKGSAPPGPVPEGKIRVYSMRFCPYARRTLLVLKAKGIGHEIININLKNKP
DWFFKKNPLGLVPVLENSQGQLIYESVITCEYLDEVYPGKKLWPDDPYEKACQKILLESF
SKMLSLMLSFPRKLNDSKQNKEECAGIKEELRKEFSKLEEVLTNKKTTFFGGNSVSMIDY
LIWPWFERQEPGELTECVSHTPKLKQWMTAMREDPAVSAFFLDAKSYQGFFRLYLQNSHE
ACDYGL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtctcagcccggagcctggcgaagggtagcgcgcccccggggccggtcccg
gagggcaagatccgcgtctacagcatgaggttctgtccatacgcacggaggaccctgctg
gtcctgaaggccaagggaatcgggcatgaaatcatcaatatcaacctgaaaaataagcct
gactggttctttaagaagaatcctcttggtctggtgccagttctggaaaacagtcagggt
caattgatctatgaatctgtcatcacctgtgagtacctggatgaggtgtatcccgggaag
aagctgtggccagatgacccttatgagaaagcttgccaaaagattctcttggagtcattc
tctaagatgctatctctgatgttaagctttccaagaaagcttaatgacagtaagcaaaat
aaagaagagtgtgctggcataaaagaagaattgcggaaggaattcagcaagttagaggag
gttctgaccaataagaagacaaccttctttggtggaaattctgtctctatgattgattac
ctcatctggccctggtttgaacggcaggaaccaggggagctaactgagtgtgtctcccac
actccaaaacttaagcaatggatgacagccatgagggaagatcctgcagtgtcagccttc
ttccttgatgcaaaaagctatcaaggtttcttccgactctacttgcaaaacagccatgag
gcctgtgactatggactctga

DBGET integrated database retrieval system