KEGG   Castor canadensis (American beaver): 109697554Help
Entry
109697554         CDS       T04791                                 

Gene name
Galnt9
Definition
(RefSeq) LOW QUALITY PROTEIN: polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00512  Mucin type O-glycan biosynthesis
ccan01100  Metabolic pathways
Module
ccan_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109697554 (Galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccan01003]
    109697554 (Galnt9)
Enzymes [BR:ccan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109697554 (Galnt9)
Glycosyltransferases [BR:ccan01003]
 O-Glycan biosynthesis
  Mucin-type
   109697554 (Galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 109697554
NCBI-ProteinID: XP_020036829
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MERSEQQGCHEDRPAGCETDGPVLKAAGTREAENSSEQCKCPLAKPERPQPPNLEMEGGK
GCRQMTYSEDLPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDDNSDNVELK
FSLDQYVHKRYPGLVKVVRNSRREGLIRARLQGWKVATAPVVGFFDAHVEFNTGWAEPAL
TRIQEDRRRIILPAIDNIKYNTFEVQQYSSAAHGYNWGLWCMYITPPQDWLDRGDESAPI
RTPAMIGCSFVVDRGYFGDIGLLDPGMEVYGAENIELGMRVWQCGGSMEVLPCSRVAHIE
RTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPSHHPGWTLGDVSERLALRQR
LKCRSFXMVLENVYPEMRVYNNTLTYGRVRNSKASGYCLDQGAEDDDRAILYPCHGMSSQ
LVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRTPTLKKCEDVARPAQRLWDFTQSGPI
VSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRNWIKHGRH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttcagagcagcagggctgccatgaggaccgtccagccggctgtgagacggac
ggtcctgtgctcaaggcagctggcaccagggaagccgaaaattcttcagagcagtgcaaa
tgcccactggccaagcctgagaggccccagcctcctaacctagaaatggaaggaggaaag
gggtgcaggcagatgacctactctgaagacctgccccaggtctccgtggtcttcatcttt
gtcaatgaggccctctcagtcatcttgcggtcggtgcacagtgtagtcaaccacacacct
tcccagctcctgaaggaggtcattctggtggacgacaacagtgacaatgttgagctcaag
ttcagcctggaccagtacgtccacaagagatacccgggcctcgtgaaagtcgtgcgtaac
agccggcgtgaaggcttgatccgggcccggctgcagggctggaaggtggccacggccccc
gttgttggcttctttgatgcccacgtggagttcaacacaggctgggctgagcctgccctc
acacggatccaggaggacagacggcggatcatcctgccggccatcgacaacatcaagtac
aacacgttcgaggtgcagcagtatagcagcgctgcccacggctacaactggggcctgtgg
tgcatgtacatcaccccgccccaggactggctggaccgcggggacgagtcggcgcccatc
aggacgcccgccatgattggctgctccttcgtggtggaccggggatactttggggacatc
ggcctgctggacccgggcatggaggtgtatggtgcagagaacatcgaactggggatgagg
gtgtggcaatgtggcggcagcatggaggtgctgccctgttcccgtgtggcccacatcgag
cgcacaaagaagccgtacaacaacgacatcgactattacgccaagcgcaacgccctgcgg
gcggccgaggtgtggatggacgacttcaagtcccacgtctacatggcttggaatatcccg
tcacaccacccagggtggactttgggggacgtgtccgagaggctggccctgcgccagagg
ctgaagtgccgaagcttcnncatggtactagagaacgtgtaccccgagatgagggtctac
aacaacaccctcacgtacggaagagtcagaaacagcaaagccagtggctactgtttggac
caaggggcagaagacgacgaccgggccatcctctacccctgccatggaatgtcctcccag
ctggtgaggtacagcgccgatggcctcctgcagctgggccccctgggctccactgccttc
ctgcctgactccaagtgtctggtggacgatggccggggtcgcacgcccaccctgaagaag
tgtgaagatgtggccaggccagcacagcggctgtgggacttcacccagagtggccccatt
gtgagcagagacacaggccggtgcctggaggtggaaatgtccaaagacgccaatttcggg
ctgcggctggtggtgcagcggtgctcggggcagaagtggacgatcagaaactggatcaaa
cacgggcggcactga

DBGET integrated database retrieval system