KEGG   Castor canadensis (American beaver): 109697575Help
Entry
109697575         CDS       T04791                                 

Gene name
Lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan03030  DNA replication
ccan03410  Base excision repair
ccan03420  Nucleotide excision repair
ccan03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109697575 (Lig1)
   03410 Base excision repair
    109697575 (Lig1)
   03420 Nucleotide excision repair
    109697575 (Lig1)
   03430 Mismatch repair
    109697575 (Lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccan03032]
    109697575 (Lig1)
   03400 DNA repair and recombination proteins [BR:ccan03400]
    109697575 (Lig1)
Enzymes [BR:ccan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109697575 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109697575 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109697575 (Lig1)
DNA replication proteins [BR:ccan03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109697575 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109697575 (Lig1)
DNA repair and recombination proteins [BR:ccan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109697575 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     109697575 (Lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     109697575 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 109697575
NCBI-ProteinID: XP_020036856
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MQRSIMSFFQPTKDSKVKKVEKEITNNGKEMEPPPKVALKERNGVVPESDSPVKRPGRKA
VRVLSSEGEEEDEALSDPKGQKPMSDSPQASPASPATCPENSPFLSNIPMDISQSGIPKR
RTARKQVPKGTIQDHLEEESEDKDRKAKKRKQEEEAKTPQEGPTEAKVAKMKEKEERDQL
MTPPEPPKPPKTDTLIKTESIPMPDTAGKQERQEEEQSKPPPKGPWTVSSFFTPRKPAVK
AKVKEESGILKKEEAKGTQDPTSYNPAKNNYHPIEDACWKPGQKVPFLAVARTFEKIEEV
SARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLELGVGDGVLLKAVAQAT
GRQLESIRAEAAEKGDVGLVAENSRSTQRLMLPPPPLSTSGVFNKFRDIARLTGSASTAK
KIDIIKGLFVACRHSEARYIARSLSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAMVD
AGKGKTAEVRKTWLEEQSMALKQTFCEVPDLDRIVPLLLEHGLEQLPKHCRLSPGVPLKP
MLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDII
SRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDL
IYLNGESLVRKPLSRRRQLLRENFVETEGEFAFATSLDTKDTEQIAEFLEQSVKDSCEGL
MVKTLDIDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAA
YDEDSEELQAICKLGTGFSDEELEAHHQSLQALVLPTPRPYVRVDGAVAPDHWLDPSAVW
EVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEQATTSAQVACLYRKQSQ
IQNQQGAGSDSDPEDFY
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtatcatgtcatttttccaacctacaaaggacagtaaagtgaagaaggtt
gagaaggagatcaccaacaatggcaaagagatggaaccccctccaaaggtggcactgaag
gagcggaatggagtggtgcctgagagtgactctccagtgaagaggccagggaggaaggca
gtgcgggtcctgagcagtgaaggagaggaggaagatgaagccctcagtgaccccaaaggc
cagaagcctatgtcagactccccacaggcctctcctgctagccctgccacatgtccagag
aacagcccttttctctccaacatccccatggacatttcccaatcaggaatcccgaagcgt
cgcacagctcggaagcaggtccccaaagggacaattcaggaccacctggaagaggagagt
gaggacaaggacagaaaagccaagaagaggaagcaggaggaagaagcaaagaccccacaa
gaaggccccacagaggctaaagtagcaaaaatgaaggaaaaagaagagagggatcagctt
atgacacctcctgagcccccaaagcctcccaaaacagacaccctaataaagacagaaagc
attcccatgcctgacacagctgggaagcaagaacggcaggaagaggagcagagcaagcct
ccccccaaaggtccctggactgtcagcagcttcttcaccccccggaagccggcggtcaaa
gctaaagtgaaagaagagtcaggaattctgaagaaggaggaagccaagggaacccaggac
ccgacgagctacaatcctgccaagaacaactaccatcccattgaagacgcctgctggaaa
ccaggccagaaggtcccttttctggcagtggcccggacatttgagaagattgaggaggtt
tctgctcggctccgtatggtggagacactgagcaacttgctgcgctctgtggtagctttg
tcacctccagacctgctcccggtcctctacctcagcctcaatcgccttgggcctccccag
caaggcctggagttgggtgttggtgatggcgtcctcctcaaggcagtggcccaggccaca
ggtcggcagctggagtccatccgggctgaggcagctgagaagggtgatgtggggctggtg
gccgagaacagccgtagcacccagagactcatgctgccaccaccccctctttccacctct
ggggtcttcaacaaattccgtgacatcgcccggctcactggtagcgcttccacagccaag
aagatagacatcatcaaaggcctcttcgttgcctgccgccactcagaagccaggtacatc
gcaaggtccctgagtgggcggctgcgccttgggctggctgagcaatcagtgctggctgcc
cttgcccaggctgtgagtcttacacctccaggacaagagtttcccccagccatggtggat
gctggaaagggcaagacagcagaggtcagaaagacgtggctagaggagcagagcatggcc
ctgaagcagacgttctgtgaggtacctgacctagaccgcatcgtccctctgctgctggaa
cacggcctggagcagctccccaaacactgcaggctgagtccaggggtccccctgaaacct
atgttggcccatcccactcggggtgtcagcgaggtcctgaagcgctttgaggaggcagcc
ttcacctgcgagtacaaatacgatgggcagagggcccagatccatgttctggaaggcggg
gaggtgaagatctttagcaggaatcaggaagataacacaggaaagtatcctgatatcatc
agccgcatccccaagattaaactcccttcagtcacatccttcatcctagacactgaagct
gtggcttgggaccgggaaaaaaagcagattcagccattccaagtgctcaccactcgcaaa
cgaaaggaggtggatgcgtcggagatccaggtgcaggtgtgtctgtatgccttcgaccta
atctacctcaatggagagtccctggtccggaagcccctgtcgcgacggcggcagctgctt
cgagaaaactttgtggaaaccgagggcgaatttgccttcgccacctctttggacaccaag
gacacagagcagatcgccgagttcttggagcagtctgtgaaagactcctgcgaggggcta
atggtgaagaccctggacatcgatgccacctatgagatcgccaagaggtcacacaattgg
ctcaagctgaaaaaggactacctcgaaggtgtgggtgacactctggacctcgtggtgatt
ggtgcctacctgggccgagggaagcgcgctggccggtatgggggcttcctgctggctgcc
tacgatgaagacagtgaggagctgcaggccatatgcaagcttggaactggctttagtgat
gaggagctggaggcacatcaccagagtctccaggccctggtactgcccactccacgcccc
tatgtgcgggtagatggtgctgtggcccccgaccactggctggaccccagtgctgtatgg
gaggtgaagtgtgccgacctctccctctcccccatctatcccgctgcccggggcctggtg
gacagtgagaaagggatctctcttcgcttccctcggttcattcgagtccgtgaagacaag
aagccagaacaggctaccaccagtgcccaggtggcctgtctgtaccggaagcaaagtcag
atccagaaccagcaaggcgcaggctcagactctgaccctgaagatttctactaa

DBGET integrated database retrieval system