KEGG   Castor canadensis (American beaver): 109697919Help
Entry
109697919         CDS       T04791                                 

Gene name
Tmprss2
Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan05164  Influenza A
ccan05202  Transcriptional misregulation in cancer
ccan05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    109697919 (Tmprss2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    109697919 (Tmprss2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    109697919 (Tmprss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109697919 (Tmprss2)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109697919 (Tmprss2)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109697919 (Tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109697919
NCBI-ProteinID: XP_020037407
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MGTQIRTTVYSEERPSCRVIVKSRKRGASDYGVQSCLLEGPPSDIGPCYENHGFQPEHLY
PPQQAVPPNPYVEYPAQYCPSPVPQYTPRVPTHASTPAIHMQPKSSSGTVCTSRTKKAVC
ITLVLGAILTGIALAVGLLWKFLENTCLVSGMACDSSGICISPSLWCDGVSDCPNGEDEN
RCVRLYGPDFILQVYSSQRKSWYPVCQDNWNQDYARAACQDMGYKDSFYSSQEVEDSSGA
TSFMKLNLSAGNTDLYKKLYHSDTCSSHLVVSLRCIECGAPLPSRQSRIVGGLNADLRDW
PWQVSLHVQGVHVCGGSIITPKWIVTAAHCVEEPLNRAWYWTAFAGILKQSDMLSDVGYP
VQKVISHPNYDSKTKNNDIALMKLQTSLTFNENVKPVCLPNPGMMLEPKQQCWIXGWGAT
YEKGKTSDVLNAATVPLIESSVCNNKYIYNNLVTSSMICAGYLEGTVDSCQGDSGGPLVT
LKNGIWWLIGDTSWGAGCAKAYRPGVYGNVTMFTDWIYQQMRASPRAAPQKADAHCLMDR
TNLTS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggggacccagataaggacaaccgtgtactctgaggagaggcccagctgtcgagtgatt
gtgaagagtaggaaaaggggagcttcagactatggggtccagagctgcctgctggagggg
ccaccatcggatattggaccttgctatgaaaaccatggattccagccggagcacctctat
cccccgcagcaggctgtgcctcccaacccctatgtagagtatcctgctcagtactgcccg
tccccggtgccccagtacaccccgagggttccaacgcacgcctcgacccctgctatccac
atgcagcccaagtcttcttcggggacagtatgcacctcaagaactaagaaagcagtgtgc
atcaccctcgtcctgggcgccatcctcacgggcattgcactggcggtaggcctgctatgg
aagttcttggagaacacatgcttggtgtctgggatggcgtgtgactcctcagggatctgc
atcagcccctctctctggtgtgacggggtgtcagactgtcccaacggggaggacgagaac
cgctgtgttcgcctctacggacctgacttcatccttcaggtgtactcatcccagaggaag
tcctggtaccccgtgtgccaagacaactggaaccaggactacgcaagggcagcatgccag
gacatgggctataaggacagtttttattctagccaagaagtagaggatagcagcggggcc
accagctttatgaaactaaacctcagtgcgggcaacaccgacctctacaaaaagctctac
cacagtgacacctgctcctcacacctggtggtctccttacgctgtatagagtgcggggcc
cccttgccaagtcgccagagcaggatcgtgggtggattgaatgctgacctgcgggactgg
ccctggcaggtcagcctgcacgtccagggtgtccatgtctgcggaggctccatcatcacc
cccaagtggatcgtgacggctgcacactgtgtggaagagccccttaaccgcgcgtggtac
tggacggcatttgcaggcattctgaaacagtctgacatgctctctgacgtcgggtaccca
gtacagaaagtgatttcccatccaaattacgattccaagaccaagaacaacgacattgct
cttatgaagttgcagacatctctaacttttaatgaaaatgtgaagccagtgtgtctgccc
aaccctggtatgatgctagagcccaaacagcagtgctggattntcggatggggggccaca
tatgagaaagggaagacctcggatgtactgaatgccgccactgtgcccctaatcgagtcc
tcggtgtgtaacaataaatacatctacaacaacctggttacatcatccatgatctgtgca
ggatacttagaggggaccgtcgactcctgccagggtgacagtggagggccgctggtcaca
ttgaagaatggcatctggtggctgattggggatacaagctggggagctggctgtgccaag
gcctaccgacctggagtgtacgggaacgtgacaatgtttactgactggatctatcaacaa
atgagggcatctccaagggcagctcctcagaaagctgatgcccactgcctgatggaccga
acaaacctgacctcatga

DBGET integrated database retrieval system